Show Order Info
Pack Size:100μg/vial
Sample Size:30ug for $99, contact us for details
Price: $240.00
Data & Images


Product Name Anti-ACTH Picoband™ Antibody
SKU/Catalog Number PB9039
Description Rabbit IgG polyclonal antibody for Pro-opiomelanocortin(POMC) detection. Tested with IHC-P in Human;Mouse;Rat.
Cite This Product Anti-ACTH Picoband™ Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9039)
Replacement Item This antibody may replace the following items: sc-20148|sc-18263 from Santa Cruz Biotechnology.
Host Rabbit
Isotype N/A
Validated Species Human, Mouse, Rat
Predicted Species Bovine

*This antibody is predicted to react with the above species based on antigen sequence similarities. Our Boster Guarantee covers the use of this product with the above species.

Application IHC-P

*Our Boster Guarantee covers the use of this product in the above tested applications.

**For positive and negative control design, consult "Tissue specificity" under Protein Target Info.

Recommended Detection Systems Boster recommends HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
*Blocking peptide can be purchased at $50. Contact us for more information
**Boster also offers various secondary antibodies for Immunoflourescecne and IHC. Take advantage of the buy 1 primary antibody get 1 secondary antibody for free promotion for the entire year 2017!
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human ACTH(138-176aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF), different from the related mouse and rat sequences by two amino acids.
Cross Reactivity No cross reactivity with other proteins
Pack Size 100μg/vial


Clonality Polyclonal
Form Lyophilized
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
*carrier free antibody available upon request.
Concentration Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Purification Immunogen affinity purified.
Isotype N/A

Protein Target Info (Source:

You can check the tissue specificity below for information on selecting positive and negative control.

Gene Name POMC
Protein Name Pro-opiomelanocortin
Molecular Weight 29424 MW
Protein Function ACTH stimulates the adrenal glands to release cortisol.
Tissue Specificity ACTH and MSH are produced by the pituitary gland.
Sequence Similarities Belongs to the POMC family.
Subcellular Localization Secreted.
Uniprot ID P01189
Alternative Names Pro-opiomelanocortin;POMC;Corticotropin-lipotropin;NPP;Melanotropin gamma;Gamma-MSH;Potential peptide;Corticotropin;Adrenocorticotropic hormone;ACTH;Melanotropin alpha;Alpha-MSH;Corticotropin-like intermediary peptide;CLIP;Lipotropin beta;Beta-LPH;Lipotropin gamma;Gamma-LPH;Melanotropin beta;Beta-MSH;Beta-endorphin;Met-enkephalin;POMC;
Research Areas |neuroscience|neurotransmitter|neuropeptides|hormones| signal transduction|growth factors/hormones|metabolism|energy metabolism| neuroscience|neurology process|endocrine system|hypothalamic pituitary adrenal axis| cancer|tumor biomarkers|cancer metabolism|metabolic signaling pathway|hormone biosynthesis| metabolism|pathways and processes|endocrine metabolism|types of disease|
*if product is indicated to react with multiple species, protein info is based on the human gene.

Background for Pro-opiomelanocortin

Adrenocorticotropic hormone (ACTH), also known as corticotropin, is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of corticosteroids. ACTH stimulates secretion of glucocorticoid steroid hormones from adrenal cortex cells, especially in the zona fasciculata of the adrenal glands. This gene can influence steroid hormone secretion by both rapid short-term mechanisms that take place within minutes and slower long-term actions. Besides, ACTH also enhances transcription of mitochondrial genes that encode for subunits of mitochondrial oxidative phosphorylation systems.

Anti-ACTH Picoband™ Antibody Images

Click the images to enlarge.

Anti-ACTH Picoband™ Antibody
Anti-ACTH Picoband antibody, PB9039-1.JPG
IHC(P): Mouse Kidney Tissue
Anti-ACTH Picoband™ Antibody
Anti-ACTH Picoband antibody, PB9039-2.JPG
IHC(P): Rat Brain Tissue
Anti-ACTH Picoband™ Antibody
Anti-ACTH Picoband antibody, PB9039-3.JPG
IHC(P): Rat Kidney Tissue
Write a review for PB9039


Chen L, Wang H, Zhao Z, Zhang Y, Huang G. Am J Chin Med. 2005;33(6):945-55. Effects Of The Extract Of A Chinese Herb Tripterygium Wilfordii Hook F On Rat Pituitary Gland.


Q: Do you offer BSA-free antibodies? Keyword: Bovine serum albumin, carrier protein, conjugation
A: Yes, please contact us at for more information about BSA-free antibodies and availability. The new BSA-free formula uses trehalose as a replacement to BSA. We have tested many alternative chemicals and found that trehalose protects the antibodies the best.
Q: Can I conjugate markers to this antibody? Can I link custom conjugates to this antibody? Keyword: conjugation
A: The antibody is stored with BSA and cannot be conjugated with markers. Carrier free antibodies are available upon request. Please contact
Q: What should I use for negative control?
A: Please contact us for negative control suggestions. You can also check expression databases such as genecards, uniprot etc. Due to logistic reasons, we do not sell serum or lysates that we use internally for positive or negative control.
Q: Where can I find troubleshooting information? What should I do if I have unexpected bands, high background, no signal, weak signal
A: You can find Boster's troubleshoot guides under tech support tab. Please contact us for further assistance on troubleshooting your experiment.
Q: What is the immunogen sequence of this antibody? Is this antibody polyclonal or monoclonal?
A: You can find the immunogen sequence under "Immunogen" and clonality in the product name.
Q: What is the expected band size? Why is it different than the observed band size?
A: The expected band size is predicted on the size of the protein. The actual band size may be affected by a few other factors including but not limited to:
1. Post-translational modification:phosphorylation, methylation, glycosylation etc. These modifications prevent SDS molecules from binding to the target protein and thus make the band size appear larger than expected
2. Post-translational cleavage: this can cause smaller bands and or multiple bands

3. Alternative splicing: the same gene can have alternative splicing patterns generating different size proteins, all with reactivities to the antibody.

4. Amino Acid R chain charge: SDS binds to positive charges. The different size and charge of the Amino Acid side chains can affect the amount of SDS binding and thus affect the observed band size.
5. Multimers: Multimers are usually broken up in reducing conditions. However if the interactions between the multimers are strong, the band may appear higher.,
Q: What is the suggested dilution ratio for Western Blot (WB), Immunohistochemistry (IHC) and or ELISA standards? What is the optimal pH for the sample?
A: Check the datasheet for the product for details on dilution ratios for different experiments. You can find the datasheet button on the right side of the product page.
Q: What is the protocol you used for your Western blotting (WB) and Immunohistochemistry (IHC)?
A: Check our protocols under the tech support tab.
Q: What are some alternative names that could be used to describe this product?
A: Some common names include but are not limited to acth antibody, alpha-msh antibody, beta endorphin antibody, beta-endorphin antibody, clip antibody, met enkephalin antibody, met-enkephalin antibody, pomc antibody