SKU A01857-1
Size 100μg/vial
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Ig Isotype N/A
Applications Flow Cytometry, IHC-P, IHC-F, ICC, WB


Product Name Anti-Beta Tubulin/TUBB Picoband™ Antibody
SKU/Catalog Number A01857-1
Storage & Handling At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Size 100μg/vial
Description Rabbit IgG polyclonal antibody for Tubulin beta chain(TUBB) detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human;Mouse;Rat.
Cite This Product Anti-Beta Tubulin/TUBB Picoband™ Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01857-1)
Host Rabbit
Contents/Buffer Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Form Lyophilized
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences.
Reactivity Human, Mouse, Rat

Assay Details

Assay Dilutions Overview

Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry(Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Immunohistochemistry(Frozen Section), 0.5-1μg/ml, Human
Immunocytochemistry, 0.5-1μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Boster's Secondary Antibodies And IHC, WB Kits

The following reagents are used to generate the images below.

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.

Images And Assay Conditions

/antibody/a01857 1 1 WB anti beta iii tubulin picoband antibody.jpg

Western blot analysis of Beta Tubulin expression in rat brian extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). Beta Tubulin at 55KD was detected using rabbit anti- Beta Tubulin Antigen Affinity purified polyclonal antibody (Catalog # A01857-1) at 0.5 μg/mL. The blot was developed using chemiluminescence (ECL) method (Catalog # EK1002).

/antibody/a01857 1 2 IHC anti beta iii tubulin picoband antibody.jpg

Beta Tubulin was detected in paraffin-embedded sections of human glioma tissues using rabbit anti- Beta Tubulin Antigen Affinity purified polyclonal antibody (Catalog # A01857-1) at 1 μg/mL. The immunohistochemical section was developed using SABC method (Catalog # SA1022).

/antibody/a01857 1 3 IHC anti beta iii tubulin picoband antibody.jpg

Beta Tubulin was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- Beta Tubulin Antigen Affinity purified polyclonal antibody (Catalog # A01857-1) at 1 μg/mL. The immunohistochemical section was developed using SABC method (Catalog # SA1022).

/a/0/a01857 1 4.png

Figure 4. Flow Cytometry analysis of U20S cells using anti-Beta Tubulin antibody (A01857-1).
Overlay histogram showing U20S cells stained with A01857-1 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Beta Tubulin Antibody (A01857-1,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.

/a/0/a01857 1 5.png

Figure 5. Flow Cytometry analysis of SiHa cells using anti-Beta Tubulin antibody (A01857-1).
Overlay histogram showing SiHa cells stained with A01857-1 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Beta Tubulin Antibody (A01857-1,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.

Target Info

Protein Target Info (Source:

Uniprot Id P07437
Gene Name TUBB
Protein Name tubulin beta class I
Tissue Specificity Ubiquitously expressed with highest levels in spleen, thymus and immature brain.
Alternative Names Tubulin beta chain; Tubulin beta-5 chain; TUBB; TUBB5; OK/SW-cl.56
Subcellular Localization cytoskeleton
Molecular Weight 50433 MW

*if product is indicated to react with multiple species, protein info is based on the human gene.


Protein Function Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
Research Areas Cytoskeleton, Cytoskeleton / Ecm, Microtubules, Signal Transduction, Subcellular Markers, Tags & Cell Markers, Tubulin

*You can search these to find other products in these research areas.
Background Tubulin beta chain is a protein that in humans is encoded by the TUBB gene. This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13.

Other Recommended Resources

Here are featured tools and databases that you might find useful.

Order Product (A01857-1)


Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.

$50 fee for conjugation. Antibody size is reduced to 50ug.

Option Price
30ug sample size $99
100ug $280
100ug+Free HRP Secondary BA1054 $280
100ug+Free Biotin Secondary BA1003 $280

USD $280

Ships in 7-10 business days.


Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

We promise all of our products perform as described in datasheets.

Write a review for A01857-1


Pim-3 is a Critical Risk Factor in Development and Prognosis of Prostate Cancer
Lentiviral-mediated growth-associated protein-43 modification of bone marrow mesenchymal stem cells improves traumatic optic neuropathy in rats
The Potential Role of HMGB1 Release in Peritoneal Dialysis-Related Peritonitis
Lentiviral-mediated growth-associated protein-43 modification of bone marrow mesenchymal stem cells improves traumatic optic neuropathy in rats