Show Order Info
Pack Size:100μg/vial
Sample Size:30ug for $99, contact us for details
Price: $240.00
Data & Images


Product Name Anti-Bmi1 Picoband™ Antibody
SKU/Catalog Number PB9133
Description Rabbit IgG polyclonal antibody for Polycomb complex protein BMI-1(BMI1) detection. Tested with WB in Human;Mouse;Rat.
Cite This Product Anti-Bmi1 Picoband™ Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9133)
Replacement Item This antibody may replace the following items: sc-10745|sc-10745-X|sc-30943|sc-30944|sc-390443|sc-390443-X|sc-8904|sc-8904-X|sc-8906|sc-8906-X from Santa Cruz Biotechnology.
Host Rabbit
Isotype N/A
Validated Species Human, Mouse, Rat
Predicted Species Bovine

*This antibody is predicted to react with the above species based on antigen sequence similarities. Our Boster Guarantee covers the use of this product with the above species.

Application WB

*Our Boster Guarantee covers the use of this product in the above tested applications.

**For positive and negative control design, consult "Tissue specificity" under Protein Target Info.

Recommended Detection Systems Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
*Blocking peptide can be purchased at $50. Contact us for more information
**Boster also offers various secondary antibodies for Immunoflourescecne and IHC. Take advantage of the buy 1 primary antibody get 1 secondary antibody for free promotion for the entire year 2017!
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human Bmi1(135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR), different from the related mouse sequence by four amino acids.
Cross Reactivity No cross reactivity with other proteins
Pack Size 100μg/vial


Clonality Polyclonal
Form Lyophilized
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
*carrier free antibody available upon request.
Concentration Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Purification Immunogen affinity purified.
Isotype N/A

Protein Target Info (Source:

You can check the tissue specificity below for information on selecting positive and negative control.

Gene Name BMI1
Protein Name Polycomb complex protein BMI-1
Molecular Weight 36949 MW
Protein Function Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2. .
Sequence Similarities Contains 1 RING-type zinc finger.
Subcellular Localization Nucleus. Cytoplasm.
Uniprot ID P35226
Alternative Names Polycomb complex protein BMI-1;Polycomb group RING finger protein 4;RING finger protein 51;BMI1;PCGF4, RNF51;
Research Areas |cell biology|cell cycle|cell differentiation| epigenetics and nuclear signaling|chromatin remodeling|polycomb silencing|prc2|transcription|cancer susceptibility|proto-oncogenes| stem cells|hematopoietic progenitors|intracellular molecules| cancer|oncoproteins/suppressors|oncoproteins|chip'ing antibodies|
*if product is indicated to react with multiple species, protein info is based on the human gene.

Background for Polycomb complex protein BMI-1

BMI1(BMI1 polycomb ring finger oncogene), also known as RNF51, is a protein which in humans is encoded by the BMI1 gene. The Bmi1 gene is highly conserved in evolution as indicated by zoo blot hybridization with Bmi1 probes corresponding to the protein-encoding domain. By fluorescence in situ hybridization, the human BMI1 gene is assigned to chromosome 10p13. BMI1 has a key role in regulating the proliferative activity of normal stem and progenitor cells. Most importantly, they provided evidence that the proliferative potential of leukemic stem and progenitor cells lacking BMI1 is compromised because they eventually undergo proliferation arrest and show signs of differentiation and apoptosis, leading to transplant failure of the leukemia. Complementation studies showed that BMI1 completely rescues these proliferative defects. Deletion analysis showed that the RING finger and helix-turn-helix domains of BMI1 were required for life span extension and repression of the tumor suppressor p16(INK4). BMI1 selectively extended the life span of these cultures. Confocal microscopy showed that BMI1 transiently colocalized with centromeres during interphase in HeLa cells.

Anti-Bmi1 Picoband™ Antibody Images

Click the images to enlarge.

Anti-Bmi1 Picoband™ Antibody
Anti-Bmi1 Picoband antibody, PB9133-1.jpg
All lanes: Anti BMI1 (PB9133) at 0.5ug/ml
WB: Recombinant Human BMI1 Protein 0.5ng
Predicted bind size: 37KD
Observed bind size: 37KD
Anti-Bmi1 Picoband™ Antibody
Anti-Bmi1 Picoband antibody, PB9133-2.jpg
All lanes: Anti BMI1 (PB9133) at 0.5ug/ml
Lane 1: Rat Spleen Tissue Lysate at 50ug
Lane 2: HT1080 Whole Cell Lysate at 40ug
Lane 3: HELA Whole Cell Lysate at 40ug
Predicted bind size: 37KD
Observed bind size: 37KD
Write a review for PB9133


Q: Do you offer BSA-free antibodies? Keyword: Bovine serum albumin, carrier protein, conjugation
A: Yes, please contact us at for more information about BSA-free antibodies and availability. The new BSA-free formula uses trehalose as a replacement to BSA. We have tested many alternative chemicals and found that trehalose protects the antibodies the best.
Q: Can I conjugate markers to this antibody? Can I link custom conjugates to this antibody? Keyword: conjugation
A: The antibody is stored with BSA and cannot be conjugated with markers. Carrier free antibodies are available upon request. Please contact
Q: What should I use for negative control?
A: Please contact us for negative control suggestions. You can also check expression databases such as genecards, uniprot etc. Due to logistic reasons, we do not sell serum or lysates that we use internally for positive or negative control.
Q: Where can I find troubleshooting information? What should I do if I have unexpected bands, high background, no signal, weak signal
A: You can find Boster's troubleshoot guides under tech support tab. Please contact us for further assistance on troubleshooting your experiment.
Q: What is the immunogen sequence of this antibody? Is this antibody polyclonal or monoclonal?
A: You can find the immunogen sequence under "Immunogen" and clonality in the product name.
Q: What is the expected band size? Why is it different than the observed band size?
A: The expected band size is predicted on the size of the protein. The actual band size may be affected by a few other factors including but not limited to:
1. Post-translational modification:phosphorylation, methylation, glycosylation etc. These modifications prevent SDS molecules from binding to the target protein and thus make the band size appear larger than expected
2. Post-translational cleavage: this can cause smaller bands and or multiple bands

3. Alternative splicing: the same gene can have alternative splicing patterns generating different size proteins, all with reactivities to the antibody.

4. Amino Acid R chain charge: SDS binds to positive charges. The different size and charge of the Amino Acid side chains can affect the amount of SDS binding and thus affect the observed band size.
5. Multimers: Multimers are usually broken up in reducing conditions. However if the interactions between the multimers are strong, the band may appear higher.,
Q: What is the suggested dilution ratio for Western Blot (WB), Immunohistochemistry (IHC) and or ELISA standards? What is the optimal pH for the sample?
A: Check the datasheet for the product for details on dilution ratios for different experiments. You can find the datasheet button on the right side of the product page.
Q: What is the protocol you used for your Western blotting (WB) and Immunohistochemistry (IHC)?
A: Check our protocols under the tech support tab.
Q: What are some alternative names that could be used to describe this product?
A: Some common names include but are not limited to bmi1 antibody, bmi 1 antibody