SKU PA1124
Size 100μg/vial
Reactivity Human
Clonality Polyclonal
Host Rabbit
Ig Isotype N/A
Applications WB


Product Name Anti-CD18/ITGB2 Antibody
SKU/Catalog Number PA1124
Storage & Handling At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Size 100μg/vial
Description Rabbit IgG polyclonal antibody for Integrin beta-2(ITGB2) detection. Tested with WB, IHC-P in Human.
Cite This Product Anti-CD18/ITGB2 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # PA1124)
Host Rabbit
Contents/Buffer Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human CD18(24-58aa, ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD), different from the related mouse sequence by five amino acids.
Reactivity Human

Assay Details

Assay Dilutions Overview

Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunohistochemistry(Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human

Boster's Secondary Antibodies And IHC, WB Kits

The following reagents are used to generate the images below.

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Images And Assay Conditions

/antibody/pa1124 1 IHC anti cd18 antibody.jpg

Anti-CD18 antibody, PA1124, IHC(P)
IHC(P): Human Uroepithelium Cancer Tissue

/antibody/pa1124 2 WB anti cd18 antibody.jpg

Anti-CD18 antibody, PA1124, Western blotting
All lanes: Anti CD18 (PA1124) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: JURKAT Whole Cell Lysate at 40ug
Lane 3: HT1080 Whole Cell Lysate at 40ug
Predicted bind size: 85KD
Observed bind size: 85KD

Target Info

Protein Target Info (Source:

Uniprot Id P05107
Gene Name ITGB2
Protein Name Integrin beta-2
Alternative Names Integrin beta-2;Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta;Complement receptor C3 subunit beta;CD18;ITGB2;CD18, MFI7;
Subcellular Localization Membrane; Single-pass type I membrane protein.
Molecular Weight 84782 MW

*if product is indicated to react with multiple species, protein info is based on the human gene.


Protein Function Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrins alpha-M/beta-2 and alpha-X/beta-2 are receptors for the iC3b fragment of the third complement component and for fibrinogen. Integrin alpha-X/beta-2 recognizes the sequence G-P-R in fibrinogen alpha-chain. Integrin alpha-M/beta-2 recognizes P1 and P2 peptides of fibrinogen gamma chain. Integrin alpha-M/beta-2 is also a receptor for factor X. Integrin alpha- D/beta-2 is a receptor for ICAM3 and VCAM1. Triggers neutrophil transmigration during lung injury through PTK2B/PYK2-mediated activation. .
Research Areas Cell Adhesion, Cell Type Markers, Cytoskeleton / Ecm, Hematopoietic Progenitors, Immunology, Integrins, Myeloid, Signal Transduction, Stem Cells

*You can search these to find other products in these research areas.
Background The beta-2 integrin chain gene is designated ITGB2 and the leukocyte antigen has been designated CD18. The 3 alpha integrin chains associated individually with the beta-2 chain as a heterodimer have gene designations of ITGAL, ITGAM, and ITGAX, and leukocyte antigen designations of CD11A, CD11B, and CD11C, respectively. The expression of CD18 was increased in lymphoblastoid cells from persons with Down syndrome, consistent with the location of the gene on chromosome 21. The ITGB2 gene spans approximately 40 kb and contains 16 exons and all exon/intron boundaries conform to the GT/AG splicing consensus. Furthermore, ITGB2 was constitutively clustered. Although it was expressed on the cell surface at normal levels and was capable of function following extracellular stimulation, it could not be activated via the “inside-out” signaling pathways.

Other Recommended Resources

Here are featured tools and databases that you might find useful.

Order Product (PA1124)


Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
Option Price
30ug sample size $99
100ug $240
100ug+Free HRP Secondary BA1054 $240
100ug+Free Biotin Secondary BA1003 $240

USD $240

Ships in 7-10 business days.


Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

We promise all of our products perform as described in datasheets.

Write a review for PA1124

Customer Q&As

Q: Do you offer BSA-free antibodies? Keyword: Bovine serum albumin, carrier protein, conjugation
A: Yes, please contact us at for more information about BSA-free antibodies and availability. The new BSA-free formula uses trehalose as a replacement to BSA. We have tested many alternative chemicals and found that trehalose protects the antibodies the best.
Q: Is your western blot protocol provided from the website applicable for all your antibodies? Keyword: applications, WB
A: The protocol is applicable for all our antibodies in WB, the NC Membrane(0.45μm or 0.22μm) and transfer time(70 mins or 50 mins) depends on the protein molecular weight, details can be found in included protocol.
Q: Can I conjugate markers to this antibody? Can I link custom conjugates to this antibody? Keyword: conjugation
A: The antibody is stored with BSA and cannot be conjugated with markers. Carrier free antibodies are available upon request. Please contact
Q: What should I use for negative control?
A: Please contact us for negative control suggestions. You can also check expression databases such as genecards, uniprot etc. Due to logistic reasons, we do not sell serum or lysates that we use internally for positive or negative control.
Q: Where can I find troubleshooting information? What should I do if I have unexpected bands, high background, no signal, weak signal
A: You can find Boster's troubleshoot guides under tech support tab. Please contact us for further assistance on troubleshooting your experiment.
Q: What is the immunogen sequence of this antibody? Is this antibody polyclonal or monoclonal?
A: You can find the immunogen sequence under "Immunogen" and clonality in the product name.
Q: What is the expected band size? Why is it different than the observed band size?
A: The expected band size is predicted on the size of the protein. The actual band size may be affected by a few other factors including but not limited to:
1. Post-translational modification:phosphorylation, methylation, glycosylation etc. These modifications prevent SDS molecules from binding to the target protein and thus make the band size appear larger than expected
2. Post-translational cleavage: this can cause smaller bands and or multiple bands

3. Alternative splicing: the same gene can have alternative splicing patterns generating different size proteins, all with reactivities to the antibody.

4. Amino Acid R chain charge: SDS binds to positive charges. The different size and charge of the Amino Acid side chains can affect the amount of SDS binding and thus affect the observed band size.
5. Multimers: Multimers are usually broken up in reducing conditions. However if the interactions between the multimers are strong, the band may appear higher.,
Q: What is the suggested dilution ratio for Western Blot (WB), Immunohistochemistry (IHC) and or ELISA standards? What is the optimal pH for the sample?
A: Check the datasheet for the product for details on dilution ratios for different experiments. You can find the datasheet button on the right side of the product page.
Q: What is the protocol you used for your Western blotting (WB) and Immunohistochemistry (IHC)?
A: Check our protocols under the tech support tab.
Q: What are some alternative names that could be used to describe this product?
A: Some common names include but are not limited to cd18 antibody, lfa 1 antibody, integrin beta 2 antibody, itgb2 antibody, mac1 antibody