Anti-CD18/ITGB2 Antibody

Boster Bio Anti-CD18/ITGB2 Antibody catalog # PA1124. Tested in WB applications. This antibody reacts with Human.

Product Info Summary

SKU: PA1124
Size: 100μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Product Name

Anti-CD18/ITGB2 Antibody

See all Integrin beta 2/CD18 products

SKU/Catalog Number

PA1124

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-CD18/ITGB2 Antibody catalog # PA1124. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-CD18/ITGB2 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # PA1124)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human CD18 (24-58aa, ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD), different from the related mouse sequence by five amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

PA1124 is reactive to ITGB2 in Human

Applications

PA1124 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For ITGB2 (Source: Uniprot.Org, NCBI)

Uniprot ID

P05107

Gene ID

3689

Gene Name

ITGB2

Full Name

Integrin beta-2

Weight

84.782kDa

Superfamily

integrin beta chain family

Alternative Names

959 beta subunit precursor)10; CD18 antigen; CD18; CD18beta 2; cell surface adhesion glycoprotein (LFA-1; CR3; Integrin beta 2; integrin beta-2; integrin, beta 2 (antigen CD18 (p95), lymphocyte function-associated antigen 1;macrophage antigen 1 (mac-1) beta subunit); integrin, beta 2 (complement component 3 receptor 3 and 4 subunit); ITGB2; LAD; LCAMB; leukocyte cell adhesion molecule CD18; leukocyte-associated antigens CD18/11A, CD18/11B, CD18/11C; LFA-1 beta; LFA-1; MAC-1 beta; MF17; MFI7; P150; p150,95 beta ITGB2 CD18, LAD, LCAMB, LFA-1, MAC-1, MF17, MFI7 integrin subunit beta 2 integrin beta-2|cell surface adhesion glycoprotein (LFA-1/CR3/P150,959 beta subunit precursor)|complement component 3 receptor 3 and 4 subunit|complement receptor C3 beta-subunit|integrin beta chain, beta 2|integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)|leukocyte cell adhesion molecule CD18|leukocyte-associated antigens CD18/11A, CD18/11B, CD18/11C|truncated integrin beta-2

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on ITGB2, check out the ITGB2 Infographic

ITGB2 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for ITGB2: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PA1124

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-CD18/ITGB2 Antibody?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-CD18/ITGB2 Antibody

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-CD18/ITGB2 Antibody

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for muscle using anti-CD18/ITGB2 antibody PA1124. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2020-03-09

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-03-09

Question

Will anti-CD18/ITGB2 antibody PA1124 work on horse WB with adipose tissue?

Verified Customer

Verified customer

Asked: 2020-02-27

Answer

Our lab technicians have not validated anti-CD18/ITGB2 antibody PA1124 on horse. You can run a BLAST between horse and the immunogen sequence of anti-CD18/ITGB2 antibody PA1124 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated horse samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in horse adipose tissue in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-02-27

Question

Will anti-CD18/ITGB2 antibody PA1124 work for WB with muscle?

Verified Customer

Verified customer

Asked: 2019-08-21

Answer

According to the expression profile of muscle, ITGB2 is highly expressed in muscle. So, it is likely that anti-CD18/ITGB2 antibody PA1124 will work for WB with muscle.

Boster Scientific Support

Answered: 2019-08-21

Question

I was wanting to use your anti-CD18/ITGB2 antibody for WB for human muscle on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human muscle identification?

J. Krishna

Verified customer

Asked: 2017-06-19

Answer

It shows on the product datasheet, PA1124 anti-CD18/ITGB2 antibody has been tested for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human muscle in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-06-19

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
PA1124
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$240.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.