Show Order Info
Application:IHC-P, WB
Price: $200.00
Data & Images


Product Name Anti-CD18 Antibody
Description Rabbit IgG polyclonal antibody for Integrin beta-2(ITGB2) detection. Tested with WB, IHC-P in Human.
Cite This Product Anti-CD18 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # PA1124)
Replacement Item This antibody may replace the following items: sc-13548|sc-28661|sc-393140|sc-393790|sc-393823|sc-51651|sc-51652|sc-65254|sc-6623|sc-6624|sc-6625|sc-71397|sc-71398|sc-71399|sc-80123|sc-8420 from Santa Cruz Biotechnology.
Host Rabbit
Isotype N/A
Validated Species Human
Application IHC-P, WB

*Our Boster Guarantee covers the use of this product in the above tested applications.

**For positive and negative control design, consult "Tissue specificity" under Protein Target Info.

Recommended Detection Systems Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
*Blocking peptide can be purchased at $50. Contact us for more information
**Boster also offers various secondary antibodies for Immunoflourescecne and IHC. Take advantage of the buy 1 primary antibody get 1 secondary antibody for free promotion for the entire year 2017!
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human CD18(24-58aa, ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD), different from the related mouse sequence by five amino acids.
Cross Reactivity No cross reactivity with other proteins
Pack Size 100μg/vial


Clonality Polyclonal
Form Lyophilized
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.
*carrier free antibody available upon request.
Concentration Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Purification Immunogen affinity purified.
Isotype N/A

Protein Target Info (Source:

You can check the tissue specificity below for information on selecting positive and negative control.

Gene Name ITGB2
Protein Name Integrin beta-2
Molecular Weight 84782 MW
Protein Function Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrins alpha-M/beta-2 and alpha-X/beta-2 are receptors for the iC3b fragment of the third complement component and for fibrinogen. Integrin alpha-X/beta-2 recognizes the sequence G-P-R in fibrinogen alpha-chain. Integrin alpha-M/beta-2 recognizes P1 and P2 peptides of fibrinogen gamma chain. Integrin alpha-M/beta-2 is also a receptor for factor X. Integrin alpha- D/beta-2 is a receptor for ICAM3 and VCAM1. Triggers neutrophil transmigration during lung injury through PTK2B/PYK2-mediated activation. .
Sequence Similarities Belongs to the integrin beta chain family.
Subcellular Localization Membrane; Single-pass type I membrane protein.
Uniprot ID P05107
Alternative Names Integrin beta-2;Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta;Complement receptor C3 subunit beta;CD18;ITGB2;CD18, MFI7;
Research Areas |signal transduction|cytoskeleton / ecm|cell adhesion|integrins| signal transduction| immunology|cell type markers| stem cells|hematopoietic progenitors|myeloid|dendritic cell lineage|
*if product is indicated to react with multiple species, protein info is based on the human gene.

Background for Integrin beta-2

The beta-2 integrin chain gene is designated ITGB2 and the leukocyte antigen has been designated CD18. The 3 alpha integrin chains associated individually with the beta-2 chain as a heterodimer have gene designations of ITGAL, ITGAM, and ITGAX, and leukocyte antigen designations of CD11A, CD11B, and CD11C, respectively. The expression of CD18 was increased in lymphoblastoid cells from persons with Down syndrome, consistent with the location of the gene on chromosome 21. The ITGB2 gene spans approximately 40 kb and contains 16 exons and all exon/intron boundaries conform to the GT/AG splicing consensus. Furthermore, ITGB2 was constitutively clustered. Although it was expressed on the cell surface at normal levels and was capable of function following extracellular stimulation, it could not be activated via the “inside-out” signaling pathways.

Anti-CD18 Antibody Images

Click the images to enlarge.

Anti-CD18 Antibody
Anti-CD18 antibody, PA1124, IHC(P)
IHC(P): Human Uroepithelium Cancer Tissue
Anti-CD18 Antibody
Anti-CD18 antibody, PA1124, Western blotting
All lanes: Anti CD18 (PA1124) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: JURKAT Whole Cell Lysate at 40ug
Lane 3: HT1080 Whole Cell Lysate at 40ug
Predicted bind size: 85KD
Observed bind size: 85KD
Write a review for PA1124


Q: Do you offer BSA-free antibodies? Keyword: Bovine serum albumin, carrier protein, conjugation
A: Yes, please contact us at for more information about BSA-free antibodies and availability. The new BSA-free formula uses trehalose as a replacement to BSA. We have tested many alternative chemicals and found that trehalose protects the antibodies the best.
Q: Is your western blot protocol provided from the website applicable for all your antibodies? Keyword: applications, WB
A: The protocol is applicable for all our antibodies in WB, the NC Membrane(0.45μm or 0.22μm) and transfer time(70 mins or 50 mins) depends on the protein molecular weight, details can be found in included protocol.
Q: Can I conjugate markers to this antibody? Can I link custom conjugates to this antibody? Keyword: conjugation
A: The antibody is stored with BSA and cannot be conjugated with markers. Carrier free antibodies are available upon request. Please contact
Q: What should I use for negative control?
A: Please contact us for negative control suggestions. You can also check expression databases such as genecards, uniprot etc. Due to logistic reasons, we do not sell serum or lysates that we use internally for positive or negative control.
Q: Where can I find troubleshooting information? What should I do if I have unexpected bands, high background, no signal, weak signal
A: You can find Boster's troubleshoot guides under tech support tab. Please contact us for further assistance on troubleshooting your experiment.
Q: What is the immunogen sequence of this antibody? Is this antibody polyclonal or monoclonal?
A: You can find the immunogen sequence under "Immunogen" and clonality in the product name.
Q: What is the expected band size? Why is it different than the observed band size?
A: The expected band size is predicted on the size of the protein. The actual band size may be affected by a few other factors including but not limited to:
1. Post-translational modification:phosphorylation, methylation, glycosylation etc. These modifications prevent SDS molecules from binding to the target protein and thus make the band size appear larger than expected
2. Post-translational cleavage: this can cause smaller bands and or multiple bands

3. Alternative splicing: the same gene can have alternative splicing patterns generating different size proteins, all with reactivities to the antibody.

4. Amino Acid R chain charge: SDS binds to positive charges. The different size and charge of the Amino Acid side chains can affect the amount of SDS binding and thus affect the observed band size.
5. Multimers: Multimers are usually broken up in reducing conditions. However if the interactions between the multimers are strong, the band may appear higher.,
Q: What is the suggested dilution ratio for Western Blot (WB), Immunohistochemistry (IHC) and or ELISA standards? What is the optimal pH for the sample?
A: Check the datasheet for the product for details on dilution ratios for different experiments. You can find the datasheet button on the right side of the product page.
Q: What is the protocol you used for your Western blotting (WB) and Immunohistochemistry (IHC)?
A: Check our protocols under the tech support tab.
Q: What are some alternative names that could be used to describe this product?
A: Some common names include but are not limited to cd18 antibody, lfa 1 antibody, integrin beta 2 antibody, itgb2 antibody, mac1 antibody