Anti-DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Monoclonal Antibody

Boster Bio Anti-DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Monoclonal Antibody catalog # M30940. Tested in IHC applications. This antibody reacts with Human.

Product Info Summary

SKU: M30940
Size: 100ug/vial
Reactive Species: Human
Host: Mouse
Application: IHC

Product Name

Anti-DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Monoclonal Antibody

See all DOG1/TMEM16A products

SKU/Catalog Number

M30940

Size

100ug/vial

Form

Liquid

Description

Boster Bio Anti-DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Monoclonal Antibody catalog # M30940. Tested in IHC applications. This antibody reacts with Human.

Storage & Handling

Cite This Product

Anti-DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Monoclonal Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # M30940)

Host

Mouse

Contents

Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.

Clonality

Monoclonal

Clone Number

DG1/447 + DOG-1.1

Immunogen

Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Reactive Species

M30940 is reactive to ANO1 in Human

Applications

M30940 is guaranteed for IHC Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistology (Formalin-fixed) (0.25-0.5ug/ml for 30 minutes at RT)
Immunofluorescence (0.5-1ug/ml)

Validation Images & Assay Conditions

Gene/Protein Information For ANO1 (Source: Uniprot.Org, NCBI)

Uniprot ID

Q5XXA6

Gene ID

55107

Gene Name

ANO1

Full Name

Anoctamin-1

Weight

114.078kDa

Superfamily

anoctamin family

Alternative Names

ANO1; anoctamin 1; DOG1; ORAOV2; TAOS2; TMEM16A ANO1 DOG1, ORAOV2, TAOS2, TMEM16A anoctamin 1 anoctamin-1|Ca2+-activated Cl- channel|anoctamin 1, calcium activated chloride channel|calcium activated chloride channel|discovered on gastrointestinal stromal tumors protein 1|oral cancer overexpressed 2|transmembrane protein 16A (eight membrane-spanning domains)|tumor-amplified and overexpressed sequence 2

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on ANO1, check out the ANO1 Infographic

ANO1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for ANO1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for M30940

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Monoclonal Antibody?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Monoclonal Antibody

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Monoclonal Antibody

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

In stock
Order Product
M30940
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$399.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.