Anti-GAPDH Picoband™ Antibody

SKU A00227
Size 100μg/vial
Reactivity Human
Clonality Polyclonal
Host Rabbit
Ig Isotype N/A
Applications WB

Overview

Product Name Anti-GAPDH Picoband™ Antibody
SKU/Catalog Number A00227
Storage & Handling At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Size 100μg/vial
Description Rabbit IgG polyclonal antibody for Glyceraldehyde-3-phosphate dehydrogenase(GAPDH) detection. Tested with WB in Human.
Cite This Product Anti-GAPDH Picoband™ Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00227)
Host Rabbit
Contents/Buffer Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Form Lyophilized
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human GAPDH (302-335aa ALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE), different from the related mouse and rat sequences by three amino acids.
Reactivity Human

Assay Details

Assay Dilutions Overview

Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Western blot, 0.1-0.5μg/ml, Human

Boster's Secondary Antibodies And IHC, WB Kits

The following reagents are used to generate the images below.

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Images And Assay Conditions

Western blot analysis of GAPDH expression in COLO320 whole cell lysates (lane 1) and A549 whole cell lysates (lane 2). GAPDH at 36KD was detected using rabbit anti- GAPDH Antigen Affinity purified polyclonal antibody (Catalog #A00227) at 0.5 μg/mL. The blot was developed using chemiluminescence (ECL) method (Catalog # EK1002).

Target Info

Protein Target Info (Source: Uniprot.org)

Uniprot Id P04406
Gene Name GAPDH
Protein Name Glyceraldehyde-3-phosphate dehydrogenase
Alternative Names Glyceraldehyde-3-phosphate dehydrogenase;GAPDH;1.2.1.12;Peptidyl-cysteine S-nitrosylase GAPDH;2.6.99.-;GAPDH;GAPD;CDABP0047, OK/SW-cl.12;
Subcellular Localization Cytoplasm, cytosol . Nucleus . Cytoplasm, perinuclear region . Membrane . Cytoplasm, cytoskeleton . Translocates to the nucleus following S- nitrosylation and interaction with SIAH1, which contains a nuclear localization signal (By similarity). Postnuclear and Perinuclear regions. .
Molecular Weight 36053 MW

*if product is indicated to react with multiple species, protein info is based on the human gene.

Ontology

Protein Function Has both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities, thereby playing a role in glycolysis and nuclear functions, respectively. Participates in nuclear events including transcription, RNA transport, DNA replication and apoptosis. Nuclear functions are probably due to the nitrosylase activity that mediates cysteine S-nitrosylation of nuclear target proteins such as SIRT1, HDAC2 and PRKDC. Modulates the organization and assembly of the cytoskeleton. Facilitates the CHP1-dependent microtubule and membrane associations through its ability to stimulate the binding of CHP1 to microtubules (By similarity). Glyceraldehyde-3-phosphate dehydrogenase is a key enzyme in glycolysis that catalyzes the first step of the pathway by converting D-glyceraldehyde 3-phosphate (G3P) into 3-phospho-D- glyceroyl phosphate. Component of the GAIT (gamma interferon- activated inhibitor of translation) complex which mediates interferon-gamma-induced transcript-selective translation inhibition in inflammation processes. Upon interferon-gamma treatment assembles into the GAIT complex which binds to stem loop-containing GAIT elements in the 3'-UTR of diverse inflammatory mRNAs (such as ceruplasmin) and suppresses their translation. .
Research Areas Human

*You can search these to find other products in these research areas.
Background Glyceraldehyde 3-phosphate dehydrogenase (abbreviated as GAPDH or less commonly as G3PDH) is an enzyme of ~37kDa that catalyzes the sixth step of glycolysis and thus serves to break down glucose for energy and carbon molecules. This gene encodes a member of the glyceraldehyde-3-phosphate dehydrogenase protein family. GAPDH is mapped to 12p13.31. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The encoded protein has additionally been identified to have uracil DNA glycosylase activity in the nucleus.

Other Recommended Resources

Here are featured tools and databases that you might find useful.

Polyclonal antibody for GAPDH detection. Host: Rabbit.Size: 100μg/vial. Tested applications: WB. Reactive species: Human. GAPDH information: Molecular Weight: 36053 MW; Subcellular Localization: Cytoplasm, cytosol . Nucleus . Cytoplasm, perinuclear region . Membrane . Cytoplasm, cytoskeleton . Translocates to the nucleus following S- nitrosylation and interaction with SIAH1, which contains a nuclear localization signal (By similarity). Postnuclear and Perinuclear regions.
Write Your Own Review
Only registered users can write reviews. Please Sign in or create an account
In stock
Order Product
A00227
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$240.00

Troubleshooting

troubleshooting_box_image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

We promise all of our products perform as described in datasheets.

Publications

microRNA-130a is an oncomir suppressing the expression of CRMP4 in gastric cancer
Age-dependent down-regulation of hyperpolarization-activated cyclic nucleotide-gated channel 4 causes deterioration of canine sinoatrial node function
The legacy effects of electromagnetic fields on bone marrow mesenchymal stem cell self-renewal and multiple differentiation potential
Polydatin attenuates diet-induced nonalcoholic steatohepatitis and fibrosis in mice
Efficacy of acetylshikonin in preventing obesity and hepatic steatosis in db/db mice
CXCL8 Antagonist Improves Diabetic Nephropathy in Male Mice With Diabetes and Attenuates High Glucose%u2013Induced Mesangial Injury
KPNA2 promotes metabolic reprogramming in glioblastomas by regulation of c-myc
Copper-transporting P-type adenosine triphosphatase (ATP7A) is associated with platinum-resistance in non-small cell lung cancer (NSCLC)
The putative tumour suppressor miR-1-3p modulates prostate cancer cell aggressiveness by repressing E2F5 and PFTK1
Dicer regulates non-homologous end joining and is associated with chemosensitivity in colon cancer patients
Expression of Hsp70 reveals significant differences between fin regeneration and inflammation in Paramisgurnus dabryanus
Rs12976445 Polymorphism Is Associated with Post-Ablation Recurrence of Atrial Fibrillation by Modulating the Expression of MicroRNA-125a and Interleukin %u2026
In Vitro Effects of HAS-2 Gene Silencing on the Proliferation and Apoptosis of the MCF-7 Human Breast Cancer Cell Line
High levels of glucose promote the activation of hepatic stellate cells via the p38-mitogen-activated protein kinase signal pathway
Protective effects of Tongxinluo on cerebral ischemia/reperfusion injury related to Connexin 43/Calpain II/Bax/Caspase-3 pathway in rat
Synergistic effect of TRAIL and irradiation in elimination of glioblastoma stem-like cells
The notch pathway promotes NF-%u03BAB activation through Asb2 in T cell acute lymphoblastic leukemia cells
2-Methoxyestradiol inhibits the proliferation and migration and reduces the radioresistance of nasopharyngeal carcinoma CNE-2 stem cells via NF-%u03BAB/HIF-1 %u2026
HDAC6 inhibition suppresses chondrosarcoma by restoring the expression of primary cilia
Radiation-induced G2/M arrest rarely occurred in glioblastoma stem-like cells
Wear particles enhance autophagy through up-regulation of CD147 to promote osteoclastogenesis
Phenylephrine promotes cardiac fibroblast proliferation through calcineurin-NFAT pathway
DYT-40, a novel synthetic 2-styryl-5-nitroimidazole derivative, blocks malignant glioblastoma growth and invasion by inhibiting AEG-1 and NF-?B signaling pathways
Overexpression of PLIN2 is a prognostic marker and attenuates tumor progression in clear cell renal cell carcinoma
Inhibition of STAT1 sensitizes radioresistant nasopharyngeal carcinoma cell line CNE-2R to radiotherapy
Downregulation of G-protein-coupled receptor 30 in the hippocampus attenuates the neuroprotection of estrogen in the critical period hypothesis
Antibody Fragments Directed against Different Portions of the Human Neural Cell Adhesion Molecule L1 Act as Inhibitors or Activators of L1 Function
Alleviation of Toxicity Caused by Overactivation of Ppar? through Ppar?-Inducible miR-181a2
Endogenous hormone 2?methoxyestradiol suppresses venous hypertension?induced angiogenesis through up? and down?regulating p53 and id?1
Function of the macrophage-capping protein in colorectal carcinoma
Regulatory Role of the MicroRNA-29b-IL-6 Signaling in the Formation of Vascular Mimicry
Targeted Disruption of V600E-Mutant BRAF Gene by CRISPR-Cpf1
Beclin-1- mediated autophagy may be involved in the elderly cognitive and affective disorders in streptozotocin-induced diabetic mice
miR-429 Inhibits Differentiation and Promotes Proliferation in Porcine Preadipocytes
Mouse Sirt3 promotes autophagy in AngII-induced myocardial hypertrophy through the deacetylation of FoxO1
The role of copper transporter ATP7A in platinum-resistance of esophageal squamous cell cancer (ESCC)
TGEV infection up-regulates FcRn expression via activation of NF-?B signaling
Combined effects of interleukin-1? and cyclic stretching on metalloproteinase expression in corneal fibroblasts in vitro
Regulation of tumorigenesis in oral epithelial cells by defined reprogramming factors Oct4 and Sox2
Design, Synthesis and Antitumor Activity of Novel link-bridge and B-Ring Modified Combretastatin A-4 (CA-4) Analogues as Potent Antitubulin Agents
miR-506 inhibits cell proliferation and invasion by targeting TET family in colorectal cancer
Iron-Mediated Lysosomal Membrane Permeabilization in Ethanol-Induced Hepatic Oxidative Damage and Apoptosis: Protective Effects of Quercetin
Targeted p53 activation by saRNA suppresses human bladder cancer cells growth and metastasis
Effect of Pulsed Electromagnetic Field on Bone Formation and Lipid Metabolism of Glucocorticoid-Induced Osteoporosis Rats through Canonical Wnt Signaling Pathway
Targeting the D1-N-methyl-D-aspartate receptor complex reduces L-dopa-induced dyskinesia in 6-hydroxydopamine-lesioned Parkinson's rats
Effects of total saponins of Panax notoginseng on immature neuroblasts in the adult olfactory bulb following global cerebral ischemia/reperfusion
Involvement of epithelial-to-mesenchymal transition and associated transforming growth factor-?/Smad signaling in paraquat-induced pulmonary fibrosis
SIRT1 protects against myocardial ischemia?reperfusion injury via activating eNOS in diabetic rats
Differential Regulation of Gene and Protein Expression by Zinc Oxide Nanoparticles in Hen?s Ovarian Granulosa Cells: Specific Roles of Nanoparticles
Small activating RNA induces myogenic differentiation of rat adipose-derived stem cells by upregulating MyoD
IL-10 Protects Neurites in Oxygen-Glucose-Deprived Cortical Neurons through the PI3K/Akt Pathway
Dasatinib suppresses invasion and induces apoptosis in nasopharyngeal carcinoma
TSPAN8 promotes gastric cancer growth and metastasis via ERK MAPK pathway
Endogenous Nodal promotes melanoma undergoing epithelial-mesenchymal transition via Snail and Slug in vitro and in vivo.
Clinicopathologic and prognostic significance of p21 (Cip1/Waf1) expression in bladder cancer.
EGFR tyrosine kinase inhibitors promote pro-caspase-8 dimerization that sensitizes cancer cells to DNA-damaging therapy
Downregulation of phosphoglycerate dehydrogenase inhibits proliferation and enhances cisplatin sensitivity in cervical adenocarcinoma cells by regulating Bcl-2 and caspase-3
Molecular responses of radiation-induced liver damage in rats
MicroRNA-100 promotes the autophagy of hepatocellular carcinoma cells by inhibiting the expression of mTOR and IGF-1R
High-density lipoprotein induces cyclooxygenase-2 expression and prostaglandin I-2 release in endothelial cells through sphingosine kinase-2
Copper-transporting P-type adenosine triphosphatase (ATP7A) is associated with platinum-resistance in non-small cell lung cancer (NSCLC)
Hydrogen sulfide attenuates myocardial fibrosis in diabetic rats through the JAK/STAT signaling pathway
Development of an IgY Antibody-Based Immunoassay for the Screening of the CYP2E1 Inhibitor/Enhancer from Herbal Medicines
Epoxyeicosanoids prevent intervertebral disc degeneration?in vitro?and?in vivo
mir-218-2 promotes glioblastomas growth, invasion and drug resistance by targeting CDC27
Cytochrome P450 26A1 modulates natural killer cells in mouse early pregnancy
Acupuncture Alters Expression of Insulin Signaling Related Molecules and Improves Insulin Resistance in OLETF Rats
Microarray-based identification of genes associated with cancer progression and prognosis in hepatocellular carcinoma
Inhibition of SDF-1?/CXCR4 Signalling in Subchondral Bone Attenuates Post-Traumatic Osteoarthritis
The combination of blueberry juice and probiotics reduces apoptosis of alcoholic fatty liver of mice by affecting SIRT1 pathway
A novel polysaccharide from Sargassum integerrimum induces apoptosis in A549 cells and prevents angiogensis in vitro and in vivo
Autophagy protects ovarian cancer-associated fibroblasts against oxidative stress
Dual Receptor Recognizing Cell Penetrating Peptide for Selective Targeting, Efficient Intratumoral Diffusion and Synthesized Anti-Glioma Therapy
Glucagon-like peptide-1 protects cardiomyocytes from advanced oxidation protein product-induced apoptosis via the PI3K/Akt/Bad signaling pathway.
Quercetin Alleviates High-Fat Diet-Induced Oxidized Low-Density Lipoprotein Accumulation in the Liver: Implication for Autophagy Regulation
Dose-dependent inhibitory effects of zoledronic acid on osteoblast viability and function in vitro
Higher heat shock factor 1 expression in tumor stroma predicts poor prognosis in esophageal squamous cell carcinoma patients
miR-124 and miR-506 inhibit colorectal cancer progression by targeting DNMT3B and DNMT1
Knockdown of Gli1 by small-interfering RNA enhances the effects of BCNU on the proliferation and apoptosis of glioma U251 cells
Lentiviral-mediated growth-associated protein-43 modification of bone marrow mesenchymal stem cells improves traumatic optic neuropathy in rats
Inhibition of DNA methyltransferase as a novel therapeutic strategy to overcome acquired resistance to dual PI3K/mTOR inhibitors
SATB1 Overexpression Regulates the Development and Progression in Bladder Cancer through EMT
Ablation of EIF5A2 induces tumor vasculature remodeling and improves tumor response to chemotherapy via regulation of matrix metalloproteinase 2 expression
Electrospun Poly(L-lactide)/Poly(?-caprolactone) Blend Nanofibrous Scaffold: Characterization and Biocompatibility with Human Adipose-Derived Stem Cells
Activation of Anterior Cingulate Cortex Extracellular Signal-Regulated Kinase-1 and -2 (ERK1/2) Regulates Acetic Acid-Induced, Pain-Related Anxiety in Adult Female Mice
Jiang Q, Ma L, Li R, Sun J. Oncotarget. 2017 Dec 1;9(15):11989-11998. doi: 10.18632/oncotarget.22857. eCollection 2018 Feb 23. Colon cancer-induced interleukin-35 inhibits beta-catenin-mediated pro-oncogenic activity
Lin L, Li R, Cai M, Huang J, Huang W, Guo Y, Yang L, Yang G, Lan T, Zhu K. Oxid Med Cell Longev. 2018 Mar 18;2018:7808656. doi: 10.1155/2018/7808656. eCollection 2018. Andrographolide Ameliorates Liver Fibrosis in Mice: Involvement of TLR4/NF-κB a...
Hu Y, Song J, Liu L, Zhang Y, Wang L, Li Q. Front Cell Infect Microbiol. 2018 Apr 9;8:110. doi: 10.3389/fcimb.2018.00110. eCollection 2018. microRNA-4516 Contributes to Different Functions of Epithelial Permeability Barrier by Targeting Poliovirus...
Zhou H, Wu G, Ma X, Xiao J, Yu G, Yang C, Xu N, Zhang B, Zhou J, Ye Z, Wang Z. J Exp Clin Cancer Res. 2018 Apr 27;37(1):89. doi: 10.1186/s13046-018-0764-9. Attenuation of TGFBR2 expression and tumour progression in prostate cancer involve diverse ...
Wang W, Qing X, Wang B, Ma K, Wei Y, Shao Z. Evid Based Complement Alternat Med. 2018 Mar 12;2018:6719460. doi: 10.1155/2018/6719460. eCollection 2018. Tauroursodeoxycholic Acid Protects Nucleus Pulposus Cells from Compression-Induced Apoptosis an...
Guo X, Fu Y, Wang Z, Wang T, Li C, Huang T, Gao F, Li C. Oxid Med Cell Longev. 2018 Mar 25;2018:4950705. doi: 10.1155/2018/4950705. eCollection 2018. Di-2-pyridylhydrazone Dithiocarbamate Butyric Acid Ester Exerted Its Proliferative Inhibition aga...
Zhang Q, Miao S, Li C, Cui K, Ge Q, Chen Z. Am J Transl Res. 2018 Mar 15;10(3):731-743. eCollection 2018. S-phase kinase-associated protein 2 impairs the inhibitory effects of miR-1236-3p on bladder tumors
Feng X, Lin J, Xing S, Liu W, Zhang G. BMC Cancer. 2017 Jan 31;17(1):90. doi: 10.1186/s12885-017-3068-0. Higher IGFBP-1 to IGF-1 serum ratio predicts unfavourable survival in patients with nasopharyngeal carcinoma
Hu J, Cao X, Pang D, Luo Q, Zou Y, Feng B, Li L, Chen Z, Huang C. Redox Biol. 2017 Aug;12:682-689. doi: 10.1016/j.redox.2017.03.023. Epub 2017 Apr 1. Tumor grade related expression of neuroglobin is negatively regulated by PPARγ and confers antiox...
Gao X, Zhu X, Sun Y, Liu J. Mol Med Rep. 2017 Jul;16(1):167-173. doi: 10.3892/mmr.2017.6598. Epub 2017 May 17. MicroRNA-141 inhibits the self-renewal of glioblastoma stem cells via Jagged1
Liao Y, Xing S, Xu B, Liu W, Zhang G. Oncotarget. 2017 May 2;8(18):30050-30062. doi: 10.18632/oncotarget.16274. Evaluation of the circulating level of fibroblast activation protein α for diagnosis of esophageal squamous cell carcinoma
Qiu T, Wang ZS, Liu XH, Chen H, Zhou JQ, Chen ZY, Wang M, Jiang GJ, Wang L, Yu G, Zhang L, Shen Y, Zhang L, He L, Wang HX, Zhang WJ. Exp Ther Med. 2017 May;13(5):1948-1955. doi: 10.3892/etm.2017.4193. Epub 2017 Mar 8. Effect of ozone oxidative pre...
Yang X, Zhang Y, Li Y, Wen T. Int J Mol Med. 2018 Mar;41(3):1536-1546. doi: 10.3892/ijmm.2018.3363. Epub 2018 Jan 4. MALAT1 enhanced the proliferation of human osteoblasts treated with ultra-high molecular weight polyethylene by targeting VEGF via...
Guo, X., Yan, F., Li, J., Zhang, C., & Bu, P. (2017). SIRT3 attenuates AngII-induced cardiac fibrosis by inhibiting myofibroblasts transdifferentiation via STAT3-NFATc2 pathway. American Journal of Translational Research, 9(7), 3258-3269. Retrieve...
Fang P, Yu M, Zhang L, Wan D, Shi M, Zhu Y, Bo P, Zhang Z. Mol Cell Endocrinol. 2017 Mar 27. pii: S0303-7207(17)30200-9. doi: 10.1016/j.mce.2017.03.027. Baicalin against obesity and insulin resistance through activation of AKT/AS160/GLUT4 pathway.
Wang H, Zhai K, Xue Y, Yang J, Yang Q, Fu Y, Hu Y, Liu F, Wang W, Cui L, Chen H, Zhang J, He W PLoS One. 2016 Dec 1;11(12):e0167307. doi: 10.1371/journal.pone.0167307. eCollection 2016. Global Deletion of TSPO Does Not Affect the Viability and G...
Wang C, Ge Q, Chen Z, Hu J, Li F, Song X, Xu H, Ye Z. Biomed Res Int. 2015;2015:304753. Doi: 10.1155/2015/304753. Epub 2015 Mar 30. A New Double Stranded Rna Suppresses Bladder Cancer Development By Upregulating P21 (Waf1/Cip1) Expression.
Wu Q, Chang Y, Zhang L, Zhang Y, Tian T, Feng G, Zhou S, Zheng Q, Han F, Huang F. J Cancer. 2013 Nov 21;4(9):727-35. Doi: 10.7150/Jca.7576. Ecollection 2013. Srpk1 Dissimilarly Impacts On The Growth, Metastasis, Chemosensitivity And Angiogenesis O...
Lu Y, Zhang K, Li C, Yao Y, Tao D, Liu Y, Zhang S, Ma Y. Plos One. 2012;7(1):E30999. Doi: 10.1371/Journal.Pone.0030999. Epub 2012 Jan 27. Piwil2 Suppresses P53 By Inducing Phosphorylation Of Signal Transducer And Activator Of Transcription 3 In Tu...
Meng R, Zhu D, Bi Y, Yang D, Wang Y. Plos One. 2013;8(1):E53557. Doi: 10.1371/Journal.Pone.0053557. Epub 2013 Jan 10. Erythropoietin Inhibits Gluconeogenesis And Inflammation In The Liver And Improves Glucose Intolerance In High-Fat Diet-Fed Mice.
Chen C, Mei H, Shi W, Deng J, Zhang B, Guo T, Wang H, Hu Y. Plos One. 2013 Apr 10;8(4):E60860. Doi: 10.1371/Journal.Pone.0060860. Print 2013. Egfp-Egf1-Conjugated Plga Nanoparticles For Targeted Delivery Of Sirna Into Injured Brain Microvascular E...
Zafar Mi, Hu C, Liu D, Shafqat Ra, Gao F. J Diabetes Res. 2014;2014:458104. Doi: 10.1155/2014/458104. Epub 2014 Aug 14. Insulin Detemir Causes Lesser Weight Gain In Comparison To Insulin Glargine: Role On Hypothalamic Npy And Galanin.
Zhao Y, Xie P, Fan H. Environ Sci Technol. 2012 Jan 3;46(1):34-41. Doi: 10.1021/Es201514H. Epub 2011 Sep 19. Genomic Profiling Of Micrornas And Proteomics Reveals An Early Molecular Alteration Associated With Tumorigenesis Induced By Mc-Lr In Mice.
Li Y, Xu N, Cai L, Gao Z, Shen L, Zhang Q, Hou W, Zhong H, Wang Q, Xiong L. Plos One. 2013;8(2):E57130. Doi: 10.1371/Journal.Pone.0057130. Epub 2013 Feb 22. Ndrg2 Is A Novel P53-Associated Regulator Of Apoptosis In C6-Originated Astrocytes Exposed...
Liu Y, Zhang Y, Lin L, Lin F, Li T, Du H, Chen R, Zheng W, Liu N. Plos One. 2013 Nov 12;8(11):E78514. Doi: 10.1371/Journal.Pone.0078514. Ecollection 2013. Effects Of Bone Marrow-Derived Mesenchymal Stem Cells On The Axonal Outgrowth Through Activa...
Liu M, Wang Q, Liu F, Cheng X, Wu X, Wang H, Wu M, Ma Y, Wang G, Hao H. Plos One. 2013 Nov 14;8(11):E79172. Doi: 10.1371/Journal.Pone.0079172. Ecollection 2013. Udp-Glucuronosyltransferase 1A Compromises Intracellular Accumulation And Anti-Cancer ...
Wang Y, Qiu H, Hu W, Li S, Yu J. Int J Mol Sci. 2014 Mar 18;15(3):4780-94. Doi: 10.3390/Ijms15034780. Over-Expression Of Platelet-Derived Growth Factor-D Promotes Tumor Growth And Invasion In Endometrial Cancer.
Zhang Y, Zheng L, Huang J, Gao F, Lin X, He L, Li D, Li Z, Ding Y, Chen L. Plos One. 2014 Apr 4;9(4):E93917. Doi: 10.1371/Journal.Pone.0093917. Ecollection 2014. Mir-124 Radiosensitizes Human Colorectal Cancer Cells By Targeting Prrx1.
Xu X, Wang Hy, Zhang Y, Liu Y, Li Yq, Tao K, Wu Ct, Jin Jd, Liu Xy. Cell Biosci. 2014 May 2;4:24. Doi: 10.1186/2045-3701-4-24. Ecollection 2014. Adipose-Derived Stem Cells Cooperate With Fractional Carbon Dioxide Laser In Antagonizing Photoaging: ...
Zhu W, Chen S, Li Z, Zhao X, Li W, Sun Y, Zhang Z, Ling W, Feng X. Nutr Metab (Lond). 2014 Aug 12;11:35. Doi: 10.1186/1743-7075-11-35. Ecollection 2014. Effects And Mechanisms Of Resveratrol On The Amelioration Of Oxidative Stress And Hepatic Stea...
Zhai B, Liu H, Li X, Dai L, Gao Y, Li C, Zhang L, Ding Y, Yu X, Zhang J. Cell Physiol Biochem. 2013;32(2):264-78. Doi: 10.1159/000354435. Epub 2013 Jul 31. Bmp15 Prevents Cumulus Cell Apoptosis Through Ccl2 And Fbn1 In Porcine Ovaries.
Liu F, Yu G, Wang G, Liu H, Wu X, Wang Q, Liu M, Liao K, Wu M, Cheng X, Hao H. Plos One. 2012;7(7):E42138. Doi: 10.1371/Journal.Pone.0042138. Epub 2012 Jul 27. An Nqo1-Initiated And P53-Independent Apoptotic Pathway Determines The Anti-Tumor Effec...
Wu G, Yu F, Xiao Z, Xu K, Xu J, Tang W, Wang J, Song E. Br J Cancer. 2011 Jun 28;105(1):146-53. Doi: 10.1038/Bjc.2011.190. Epub 2011 May 31. Hepatitis B Virus X Protein Downregulates Expression Of The Mir-16 Family In Malignant Hepatocytes In Vitro.
Yu Y, Xie M, He Yl, Xu Wq, Zhu S, Cao Lz. Ai Zheng. 2008 Sep;27(9):929-33. [Role Of High Mobility Group Box 1 In Adriamycin-Induced Apoptosis In Leukemia K562 Cells].
Xu G, Zhang Y, Wei J, Jia W, Ge Z, Zhang Z, Liu X. Bmc Cancer. 2013 Oct 10;13:469. Doi: 10.1186/1471-2407-13-469. Microrna-21 Promotes Hepatocellular Carcinoma Hepg2 Cell Proliferation Through Repression Of Mitogen-Activated Protein Kinase-Kinase 3.
Wu Ty, Zhang Th, Qu Lm, Feng Jp, Tian Ll, Zhang Bh, Li Dd, Sun Yn, Liu M. Int J Clin Exp Pathol. 2013 Dec 15;7(1):56-63. Ecollection 2014. Mir-19A Is Correlated With Prognosis And Apoptosis Of Laryngeal Squamous Cell Carcinoma By Regulating Timp-2...
Zhou X, Wu W, Chen J, Wang X, Wang Y. Nutr Metab (Lond). 2015 Mar 8;12:10. Doi: 10.1186/S12986-015-0006-5. Ecollection 2015. Amp-Activated Protein Kinase Is Required For The Anti-Adipogenic Effects Of Alpha-Linolenic Acid.
Zhang K, Lu Y, Yang P, Li C, Sun H, Tao D, Liu Y, Zhang S, Ma Y. Plos One. 2012;7(7):E41973. Doi: 10.1371/Journal.Pone.0041973. Epub 2012 Jul 27. Hili Inhibits Tgf-?? Signaling By Interacting With Hsp90 And Promoting T??r Degradation.
Huang Gf, Zou J, Shi J, Zhang Dy, Pen Hf, Zhang Q, Gao Y, Wang By. Evid Based Complement Alternat Med. 2014;2014:731395. Doi: 10.1155/2014/731395. Epub 2014 May 27. The Effect Of Electroacupuncture On The Extracellular Matrix Synthesis And Degrada...
Cheng C, Wan F, Liu L, Zeng F, Xing S, Wu X, Chen X, Zhu Z. Plos One. 2014 May 16;9(5):E97406. Doi: 10.1371/Journal.Pone.0097406. Ecollection 2014. Overexpression Of Satb1 Is Associated With Biologic Behavior In Human Renal Cell Carcinoma.
Write a review for A00227
Copyright © 2019 Boster Biological Technology Inc. All rights reserved.