Show Order Info
SKU:M00898
Pack Size:100μg/vial
Validated Species:Human, Monkey
Host:Mouse
Clonality:Monoclonal
Clone Number:13H4
Application:Flow Cytometry, IHC-P, WB
Technical
Specs
Kit
Components
Gene
Information
Application
Data & Images
Reviews
Publications
Customer
Q&As

Overview

Product Name Anti-GNAQ Picoband™ Antibody (monoclonal, 13H4)
SKU/Catalog Number M00898
Description Mouse IgG monoclonal antibody for GNAQ detection. Tested with WB, IHC-P, FCM in Human;Monkey.
Cite This Product Anti-GNAQ Picoband™ Antibody (monoclonal, 13H4) 13H4 (Boster Biological Technology, Pleasanton CA, USA, Catalog # M00898)
Host Mouse
Validated Species Human, Monkey
Application Flow Cytometry, IHC-P, WB

*Our Boster Guarantee covers the use of this product in the above tested applications.

**For positive and negative control design, consult "Tissue specificity" under Protein Target Info.

Recommended Detection Systems Boster recommends Enhanced Chemiluminescent Kit with anti-Mouse IgG (EK1001) for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit (SV0001-1) for IHC(P).
*Blocking peptide can be purchased at $50. Contact us for more information
**Boster also offers various secondary antibodies for Immunoflourescecne and IHC. Take advantage of the buy 1 primary antibody get 1 secondary antibody for free promotion for the entire year 2018!
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ(102-138aa KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND), identical to the related mouse and rat sequences.
Cross Reactivity No cross reactivity with other proteins.
Pack Size 100μg/vial

Properties

Clonality Monoclonal
Clone Number 13H4
Form Lyophilized
Contents Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration 0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.
Storage At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Isotype IgG2b

Protein Target Info (Source: Uniprot.org)

You can check the tissue specificity below for information on selecting positive and negative control.

Gene Name GNAQ
Protein Function Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Regulates B-cell selection and survival and is required to prevent B-cell-dependent autoimmunity. Regulates chemotaxis of BM-derived neutrophils and dendritic cells.
Tissue Specificity Predominantly expressed in ovary, prostate, testis and colon. Down-regulated in the peripheral blood lymphocytes (PBLs) of rheumatoid arthritis patients.
Subcellular Localization Nucleus. Nucleus membrane. Membrane.
Uniprot ID P50148
Alternative Names Guanine nucleotide-binding protein G(q) subunit alpha; Guanine nucleotide-binding protein alpha-q; GNAQ; GAQ
Reseach Areas Apoptosis, Cancer, Cardiovascular, G Protein Signaling, Heterotrimeric G Proteins, Neural Signal Transduction, Neurology Process, Neuroscience, Nucleotide Messenger, Second Messenger, Signal Transduction, Signaling Pathway, Small G Proteins|
*if product is indicated to react with multiple species, protein info is based on the human gene.

Background for GNAQ

Guanine nucleotide-binding protein G(q) subunit alpha is a protein that in humans is encoded by the GNAQ gene. Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GDP for GTP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta. Mutations in this gene have been found associated to cases of Sturge-Weber syndrome and port-wine stains.

Anti-GNAQ Picoband™ Antibody (monoclonal, 13H4) Images

Click the images to enlarge.

Anti-GNAQ Picoband™ Antibody (monoclonal, 13H4)
Boster Kit Box
Write a review for M00898