Anti-GNAQ Picoband™ Antibody (monoclonal, 13H4)

SKU M00898
Size 100μg/vial
Reactivity Human, Monkey
Clonality Monoclonal
Clone Number 13H4
Host Mouse
Ig Isotype IgG2b
Applications Flow Cytometry, IHC-P, WB

Overview

Product Name Anti-GNAQ Picoband™ Antibody (monoclonal, 13H4)
SKU/Catalog Number M00898
Storage & Handling At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Size 100μg/vial
Description Mouse IgG monoclonal antibody for GNAQ detection. Tested with WB, IHC-P, FCM in Human;Monkey.
Cite This Product Anti-GNAQ Picoband™ Antibody (monoclonal, 13H4) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M00898)
Host Mouse
Contents/Buffer Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Form Lyophilized
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ(102-138aa KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND), identical to the related mouse and rat sequences.
Reactivity Human, Monkey

Assay Details

Assay Dilutions Overview

Concentration: 0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry(Paraffin-embedded Section), 0.5-1μg/ml
Flow Cytometry, 1-3μg/1x106 cells

Boster's Secondary Antibodies And IHC, WB Kits

The following reagents are used to generate the images below.

Boster recommends Enhanced Chemiluminescent Kit with anti-Mouse IgG (EK1001) for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit (SV0001-1) for IHC(P).

Images And Assay Conditions

Boster Kit Box

Target Info

Protein Target Info (Source: Uniprot.org)

Uniprot Id P50148
Gene Name GNAQ
Protein Name guanine nucleotide binding protein (G protein), q polypeptide
Tissue Specificity Predominantly expressed in ovary, prostate, testis and colon. Down-regulated in the peripheral blood lymphocytes (PBLs) of rheumatoid arthritis patients.
Alternative Names Guanine nucleotide-binding protein G(q) subunit alpha; Guanine nucleotide-binding protein alpha-q; GNAQ; GAQ
Subcellular Localization Nucleus. Nucleus membrane. Membrane.

*if product is indicated to react with multiple species, protein info is based on the human gene.

Ontology

Protein Function Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Regulates B-cell selection and survival and is required to prevent B-cell-dependent autoimmunity. Regulates chemotaxis of BM-derived neutrophils and dendritic cells.
Research Areas Human, Monkey

*You can search these to find other products in these research areas.
Background Guanine nucleotide-binding protein G(q) subunit alpha is a protein that in humans is encoded by the GNAQ gene. Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GDP for GTP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta. Mutations in this gene have been found associated to cases of Sturge-Weber syndrome and port-wine stains.

Other Recommended Resources

Here are featured tools and databases that you might find useful.

Mouse IgG monoclonal antibody for GNAQ detection. Tested with WB, IHC-P, FCM in Human;Monkey.
Write Your Own Review
Only registered users can write reviews. Please Sign in or create an account
In stock
Order Product
M00898
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

Troubleshooting

troubleshooting_box_image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

We promise all of our products perform as described in datasheets.

Write a review for M00898