Anti-HIF-2-alpha/EPAS1 Antibody

Boster Bio Anti-HIF-2-alpha/EPAS1 Antibody catalog # PA1129-1. Tested in IHC, WB applications. This antibody reacts with Rat. Cited in 1 publication(s).

Product Info Summary

SKU: PA1129-1
Size: 100μg/vial
Reactive Species: Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-HIF-2-alpha/EPAS1 Antibody

See all HIF-2 alpha/EPAS1 products

SKU/Catalog Number

PA1129-1

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-HIF-2-alpha/EPAS1 Antibody catalog # PA1129-1. Tested in IHC, WB applications. This antibody reacts with Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-HIF-2-alpha/EPAS1 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # PA1129-1)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at N-terminus of rat HIF-2-alpha (202-240aa YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

PA1129-1 is reactive to Epas1 in Rat

Applications

PA1129-1 is guaranteed for IHC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Rat

Validation Images & Assay Conditions

Gene/Protein Information For Epas1 (Source: Uniprot.Org, NCBI)

Uniprot ID

Q9JHS1

Gene ID

29452

Gene Name

Epas1

Full Name

Endothelial PAS domain-containing protein 1

Weight

96.718kDa

Alternative Names

anti hif 2 alpha; HIF-2 alpha; Basic-helix-loop-helix-PAS protein MOP2; BHLHE73; Class E basic helix-loop-helix protein 73; ECYT4; endothelial PAS domain protein 1; endothelial PAS domain-containing protein 1; EPAS1; EPAS-1; HIF 2A; HIF-1-alpha-like factor; HIF-1alpha-like factor; HIF2 alpha; HIF-2 alpha; hif2a angiogenesis; HIF2A; HIF-2-alpha; HIF2-alpha; HLF; hypoxia-inducible factor 2 alpha; Hypoxia-inducible factor 2-alpha; Member of PAS protein 2; MOP2; PAS domain-containing protein 2; PASD2 Epas1|HIF-2 alpha, HIF2 alpha, HLF, Hif2a|endothelial PAS domain protein 1|endothelial PAS domain-containing protein 1|EPAS-1|HIF-2-alpha|HIF2-alpha|hypoxia inducible factor 2, alpha subunit|hypoxia inducible factor 2a|hypoxia-inducible factor 2-alpha

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on Epas1, check out the Epas1 Infographic

Epas1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for Epas1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

PA1129-1 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Proper autophagy is indispensable for angiogenesis during chick embryo development

Have you used Anti-HIF-2-alpha/EPAS1 Antibody?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-HIF-2-alpha/EPAS1 Antibody

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-HIF-2-alpha/EPAS1 Antibody

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
PA1129-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.