Anti-HLA-B Antibody Picoband™

Boster Bio Anti-HLA-B Antibody Picoband™ catalog # A00186-1. Tested in WB applications. This antibody reacts with Human.

Product Info Summary

SKU: A00186-1
Size: 100μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Product Name

Anti-HLA-B Antibody Picoband™

See all HLA-B products

SKU/Catalog Number







Boster Bio Anti-HLA-B Antibody Picoband™ catalog # A00186-1. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-HLA-B Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00186-1)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the C-terminus of human HLA-B (52-89aa EQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEA).

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00186-1 is reactive to HLA-B in Human


A00186-1 is guaranteed for WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For HLA-B (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

HLA class I histocompatibility antigen, B alpha chain



Alternative Names

ankylosing spondylitis; AS; b'DT; Bw-22; Bw-4; Bw-41; Bw-44; Bw-45; Bw-46; Bw-47; Bw-48; Bw-50; Bw-52; Bw-53; Bw-54; Bw-55; Bw-56; Bw-57; Bw-58; Bw-60; HLA class I histocompatibility antigen, B alpha chain; HLA class I histocompatibility antigen, B-12 alpha chain; HLA class I histocompatibility antigen, B-21 alpha chain; HLA class I histocompatibility antigen, B-5 alpha chain; HLA class I histocompatibility antigen, B-7 alpha chain; HLAB; HLA-B27; HLA-B73; leukocyte antigen class I-B; lymphocyte antigen; major histocompatibility complex, class I, B; MGC111087; MHC class I antigen B*13; MHC cla HLA-B AS, B-4901, HLAB major histocompatibility complex, class I, B major histocompatibility complex, class I, B|HLA class I antigen HLA-B|HLA class I histocompatibility antigen, B alpha chain|MHC HLA-B cell surface glycoprotein|MHC HLA-B transmembrane glycoprotein|MHC class 1 antigen|MHC class I antigen HLA-B alpha chain|MHC class I antigen HLA-B heavy chain|MHC class I antigen SHCHA|MHC class I molecule|leukocyte antigen class I-B

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on HLA-B, check out the HLA-B Infographic

HLA-B infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for HLA-B: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A00186-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-HLA-B Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-HLA-B Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-HLA-B Antibody Picoband™


We are currently using anti-HLA-B antibody A00186-1 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on horse tissues as well?

Verified Customer

Verified customer

Asked: 2020-04-29


The anti-HLA-B antibody (A00186-1) has not been validated for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-04-29


I have a question about product A00186-1, anti-HLA-B antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

F. Rodriguez

Verified customer

Asked: 2020-03-18


We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00186-1 anti-HLA-B antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-03-18


Would anti-HLA-B antibody A00186-1 work on horse WB with liver?

Verified Customer

Verified customer

Asked: 2019-11-11


Our lab technicians have not validated anti-HLA-B antibody A00186-1 on horse. You can run a BLAST between horse and the immunogen sequence of anti-HLA-B antibody A00186-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated horse samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in horse liver in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-11-11


Is this A00186-1 anti-HLA-B antibody reactive to the isotypes of HLA-B?

Verified Customer

Verified customer

Asked: 2019-07-04


The immunogen of A00186-1 anti-HLA-B antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human HLA-B (52-89aa EQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEA). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-07-04


We are interested in to test anti-HLA-B antibody A00186-1 on human brain for research purposes, then I may be interested in using anti-HLA-B antibody A00186-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-02-19


The products we sell, including anti-HLA-B antibody A00186-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-02-19


Does anti-HLA-B antibody A00186-1 work for WB with brain?

Verified Customer

Verified customer

Asked: 2018-08-16


According to the expression profile of brain, HLA-B is highly expressed in brain. So, it is likely that anti-HLA-B antibody A00186-1 will work for WB with brain.

Boster Scientific Support

Answered: 2018-08-16


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.