Overview
Product Name |
Anti-HLA-B Antibody Picoband™
|
Catalog# |
A00186-1 |
Pack Size |
100μg/vial |
Storage & Handling |
Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles. |
Description |
Boster Bio Anti-HLA-B Antibody Picoband™ catalog # A00186-1. Tested in WB applications. This antibody reacts with Human. Supplied as 100μg/vial in Lyophilized form antibody. |
Cite This Product |
Anti-HLA-B Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00186-1)
|
Antibodies Validation |
Antibodies Validation Information
|
Similar Products From Other Companies |
Anti-HLA-B Antibody Picoband™ may replace the following items: sc 59233|sc 8606|sc 377101|sc 8607. |
Product Specs
Host |
Rabbit |
Reactive Species |
Human |
Applications |
WB
*Our Boster Guarantee covers the use of this product in the above
tested applications.
*Innovating Scientists reward: if you test this antibody on a species or application not listed above and share with us your results, we will provide you a full credit to purchase Boster products. |
Related Products |
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
*Blocking peptide can be purchased at $100. Contact us for more information.
**Boster also offers various secondary antibodies for Immunoflourescecne and IHC. Take advantage of the buy 1 primary antibody get 1 secondary antibody for free promotion all year round. |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human HLA-B (52-89aa EQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEA). |
Cross Reactivity |
No cross reactivity with other proteins. |
Gene/Protein Basic Information For HLA-B (Source: Uniprot.org, NCBI)
Uniprot Id | O19569 |
---|
Gene Name | HLA-B |
---|
Molecular Weight | 10606 MW |
---|
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".
For more info on HLA-B, check out the HLA-B Infographic
We have 30,000+ of these available, one for each gene! Check them out.
Want a nice infographic on your next protein? Boster's got them all. All proteins in the human genome, and some, can be found in the Boster Bio gene infographics. Download it and share it with your colleagues and friends. Big size posters available upon request.
In this infographic you will see the following information for HLA-B: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. Some times it even contains some opt-ed articles the Boster team on the scientific news and clinical impacts of this protein, though not all have that. Too many proteins, you know.
Take me to the HLA-B infographic
Our Boster Quality Guarantee for Anti-HLA-B Antibody Picoband™ covers its use in the following applications.
Western blot, 0.1-0.5μg/ml, Human
*The recommended dilution ratios/concentrations are for reference only and optimal dilutions/concentrations should be determined by the end user.

Figure 1. Western blot analysis of HLA-B using anti-HLA-B antibody (A00186-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: HELA whole Cell lysates,
Lane 2: HEPG2 whole Cell lysates,
Lane 3: SGC7901 whole Cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-HLA-B antigen affinity purified polyclonal antibody (Catalog # A00186-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for HLA-B at approximately 45KD. The expected band size for HLA-B is at 45KD.
Specific Protocols
Boster provides comprehensive technical information for WB, IHC/IF/ICC, Flow Cytometry sample preparation protocols, assay protocols, troubleshooting tips and assay optimization tips.
Did You Know ?
That Boster Bio offers comprehensive selection of Western blot and IHC reagents? Great quality and save up to 50% cost.
Other Recommended Resources
Here are featured tools and databases that you might find useful.
Total number of citations: 0
|
0 reviews
Contact us with any questions at [email protected] or go to contact us
Questions and answers from customers related to A00186-1 Anti-HLA-B Antibody Picoband™
6 Related Questions
Question
We are currently using anti-HLA-B antibody A00186-1 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on horse tissues as well?
Verified Customer
Asked: 2020-04-29
Answer
The anti-HLA-B antibody (A00186-1) has not been validated for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-04-29
Question
I have a question about product A00186-1, anti-HLA-B antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
F. Rodriguez
Asked: 2020-03-18
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00186-1 anti-HLA-B antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-03-18
Question
Would anti-HLA-B antibody A00186-1 work on horse WB with liver?
Verified Customer
Asked: 2019-11-11
Answer
Our lab technicians have not validated anti-HLA-B antibody A00186-1 on horse. You can run a BLAST between horse and the immunogen sequence of anti-HLA-B antibody A00186-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated horse samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in horse liver in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-11-11
Question
Is this A00186-1 anti-HLA-B antibody reactive to the isotypes of HLA-B?
Verified Customer
Asked: 2019-07-04
Answer
The immunogen of A00186-1 anti-HLA-B antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human HLA-B (52-89aa EQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEA). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-07-04
Question
We are interested in to test anti-HLA-B antibody A00186-1 on human brain for research purposes, then I may be interested in using anti-HLA-B antibody A00186-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Asked: 2019-02-19
Answer
The products we sell, including anti-HLA-B antibody A00186-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-02-19
Question
Does anti-HLA-B antibody A00186-1 work for WB with brain?
Verified Customer
Asked: 2018-08-16
Answer
According to the expression profile of brain, HLA-B is highly expressed in brain. So, it is likely that anti-HLA-B antibody A00186-1 will work for WB with brain.
Boster Scientific Support
Answered: 2018-08-16