Product Info Summary
SKU: | M05077-Dyl488 |
---|---|
Size: | 50ug/vial |
Reactive Species: | Human |
Host: | Mouse |
Application: | Flow Cytometry |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Human AMPK beta 2 DyLight® 488 conjugated PRKAB2 Antibody(monoclonal, 6G1)
View all AMPK beta 2/PRKAB2 Antibodies
SKU/Catalog Number
M05077-Dyl488
Size
50ug/vial
Form
Liquid
Description
Boster Bio Anti-Human AMPK beta 2 DyLight® 488 conjugated PRKAB2 Antibody (monoclonal, 6G1) catalog # M05077-Dyl488. Tested in Flow Cytometry applications. This antibody reacts with Human.
Storage & Handling
At -20°C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
Cite This Product
Anti-Human AMPK beta 2 DyLight® 488 conjugated PRKAB2 Antibody(monoclonal, 6G1) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M05077-Dyl488)
Host
Mouse
Contents
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Clonality
Monoclonal
Clone Number
6G1
Isotype
IgG2b
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 2 (56-89aa DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross Reactivity
No cross reactivity with other proteins.
Reactive Species
M05077-Dyl488 is reactive to PRKAB2 in Human
Applications
M05077-Dyl488 is guaranteed for Flow Cytometry Boster Guarantee
Background of AMPK beta 2/PRKAB2
5'-AMP-activated protein kinase subunit beta-2 is an enzyme that in humans is encoded by the PRKAB2 gene. The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. It is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.
Submit A Review
Assay dilution & Images
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.
Flow Cytometry, 1-3μg/1x106 cells
Validation Images & Assay Conditions

Click image to see more details
Boster Kit Box
Protein Target Info & Infographic
Gene/Protein Information For PRKAB2 (Source: Uniprot.Org, NCBI)
Uniprot ID
O43741
Gene ID
5565
Gene Name
PRKAB2
Full Name
5'-AMP-activated protein kinase subunit beta-2
Weight
30.302kDa
Superfamily
5'-AMP-activated protein kinase beta subunit family
Alternative Names
5'-AMP-activated protein kinase, beta-2 subunit; AMPK beta 2; AMPK beta 2,5'-AMP-activated protein kinase subunit beta-2; AMPK beta-2 chain; AMPK subunit beta-2; MGC61468; PRKAB2; protein kinase, AMP-activated, beta 2 non-catalytic subunit PRKAB2 protein kinase AMP-activated non-catalytic subunit beta 2 5-AMP-activated protein kinase subunit beta-2|5-AMP-activated protein kinase, beta-2 subunit|AMP-activated protein kinase beta 2 non-catalytic subunit|AMPK beta 2|AMPK beta-2 chain|AMPK subunit beta-2|protein kinase, AMP-activated, beta 2 non-catalytic subunit
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".For more info on PRKAB2, check out the PRKAB2 Infographic

We have 30,000+ of these available, one for each gene! check them out.
In this infographic you will see the following information for PRKAB2: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]
Specific Publications For Anti-Human AMPK beta 2 DyLight® 488 conjugated PRKAB2 Antibody(monoclonal, 6G1) (M05077-Dyl488)
No publications found for M05077-Dyl488
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Human AMPK beta 2 DyLight® 488 conjugated PRKAB2 Antibody(monoclonal, 6G1)?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-Human AMPK beta 2 DyLight® 488 conjugated PRKAB2 Antibody(monoclonal, 6G1)
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question