Anti-Human AMPK beta 2 DyLight® 488 conjugated PRKAB2 Antibody(monoclonal, 6G1)

Boster Bio Anti-Human AMPK beta 2 DyLight® 488 conjugated PRKAB2 Antibody (monoclonal, 6G1) catalog # M05077-Dyl488. Tested in Flow Cytometry applications. This antibody reacts with Human.

Product Info Summary

SKU: M05077-Dyl488
Size: 50ug/vial
Reactive Species: Human
Host: Mouse
Application: Flow Cytometry

Product Name

Anti-Human AMPK beta 2 DyLight® 488 conjugated PRKAB2 Antibody(monoclonal, 6G1)

See all AMPK beta 2/PRKAB2 products

SKU/Catalog Number







Boster Bio Anti-Human AMPK beta 2 DyLight® 488 conjugated PRKAB2 Antibody (monoclonal, 6G1) catalog # M05077-Dyl488. Tested in Flow Cytometry applications. This antibody reacts with Human.

Storage & Handling

At 2-8?C for one year from date of receipt. Protect from light. Do not freeze.

Cite This Product

Anti-Human AMPK beta 2 DyLight® 488 conjugated PRKAB2 Antibody(monoclonal, 6G1) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M05077-Dyl488)




Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.



Clone Number





A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 2 (56-89aa DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

M05077-Dyl488 is reactive to PRKAB2 in Human


M05077-Dyl488 is guaranteed for Flow Cytometry Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For PRKAB2 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

5'-AMP-activated protein kinase subunit beta-2




5'-AMP-activated protein kinase beta subunit family

Alternative Names

5'-AMP-activated protein kinase, beta-2 subunit; AMPK beta 2; AMPK beta 2,5'-AMP-activated protein kinase subunit beta-2; AMPK beta-2 chain; AMPK subunit beta-2; MGC61468; PRKAB2; protein kinase, AMP-activated, beta 2 non-catalytic subunit PRKAB2 protein kinase AMP-activated non-catalytic subunit beta 2 5-AMP-activated protein kinase subunit beta-2|5-AMP-activated protein kinase, beta-2 subunit|AMP-activated protein kinase beta 2 non-catalytic subunit|AMPK beta 2|AMPK beta-2 chain|AMPK subunit beta-2|protein kinase, AMP-activated, beta 2 non-catalytic subunit

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on PRKAB2, check out the PRKAB2 Infographic

PRKAB2 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for PRKAB2: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for M05077-Dyl488

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Human AMPK beta 2 DyLight® 488 conjugated PRKAB2 Antibody(monoclonal, 6G1)?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Human AMPK beta 2 DyLight® 488 conjugated PRKAB2 Antibody(monoclonal, 6G1)

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-Human AMPK beta 2 DyLight® 488 conjugated PRKAB2 Antibody(monoclonal, 6G1)


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.