Anti-Human Bax DyLight® 550 conjugated Antibody

BAX antibody

Boster Bio Anti-Human Bax DyLight® 550 conjugated Antibody catalog # A00183-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human. Cited in 7 publication(s).

Product Info Summary

SKU: A00183-Dyl550
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry

Customers Who Bought This Also Bought

Product Name

Anti-Human Bax DyLight® 550 conjugated Antibody

View all BAX Antibodies

SKU/Catalog Number

A00183-Dyl550

Size

100 μg/vial

Form

Liquid

Description

Boster Bio Anti-Human Bax DyLight® 550 conjugated Antibody catalog # A00183-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.

Storage & Handling

At -20°C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.

Cite This Product

Anti-Human Bax DyLight® 550 conjugated Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00183-Dyl550)

Host

Rabbit

Contents

Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00183-Dyl550 is reactive to BAX in Human

Applications

A00183-Dyl550 is guaranteed for Flow Cytometry Boster Guarantee

Background of BAX

Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For BAX (Source: Uniprot.org, NCBI)

Uniprot ID

Q07812

Gene ID

581

Gene Name

BAX

Full Name

Apoptosis regulator BAX

Weight

21.184kDa

Superfamily

Bcl-2 family

Alternative Names

apoptosis regulator BAX; Bax; BCL2-associated X protein; Bcl2-L-4; BCL2L4bcl2-L-4; Bcl-2-like protein 4 BAX BCL2L4 BCL2 associated X, apoptosis regulator apoptosis regulator BAX|BCL2 associated X protein|BCL2-associated X protein omega|Baxdelta2G9|Baxdelta2G9omega|Baxdelta2omega|bcl-2-like protein 4|bcl2-L-4

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on BAX, check out the BAX Infographic

BAX infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BAX: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

A00183-Dyl550 has been cited in 7 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Newcastle disease virus V protein inhibits apoptosis in DF-1 cells by downregulating TXNL1

The Effects of Fasudil at Different Doses on Acute Myocardial Infarction in Rats

Knockdown of High Mobility Group-Box 3 (HMGB3) Expression Inhibits Proliferation, Reduces Migration, and Affects Chemosensitivity in Gastric Cancer Cells

Fenofibrate, a PPAR? agonist, protect proximal tubular cells from albumin-bound fatty acids induced apoptosis via the activation of NF-kB

Sun Y, Xu Hj, Zhao Yx, Wang Lz, Sun Lr, Wang Z, Sun Xf. Evid Based Complement Alternat Med. 2013;2013:690164. Doi: 10.1155/2013/690164. Epub 2013 Mar 19. Crocin Exhibits Antitumor Effects On Human Leukemia Hl-60 Cells In Vitro And In Vivo.

Rasul A, Yu B, Zhong L, Khan M, Yang H, Ma T. Oncol Rep. 2012 May;27(5):1481-7. Doi: 10.3892/Or.2012.1694. Epub 2012 Feb 21. Cytotoxic Effect Of Evodiamine In Sgc-7901 Human Gastric Adenocarcinoma Cells Via Simultaneous Induction Of Ap...

Qin R, Shen H, Cao Y, Fang Y, Li H, Chen Q, Xu W. Plos One. 2013 Oct 1;8(10):E76486. Doi: 10.1371/Journal.Pone.0076486. Ecollection 2013. Tetrandrine Induces Mitochondria-Mediated Apoptosis In Human Gastric Cancer Bgc-823 Cells.

Have you used Anti-Human Bax DyLight® 550 conjugated Antibody?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Human Bax DyLight® 550 conjugated Antibody

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

14 Customer Q&As for Anti-Human Bax DyLight® 550 conjugated Antibody

Question

Will anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550 work for Flow Cytometry with mucosa of transverse colon?

Verified Customer

Verified customer

Asked: 2020-03-24

Answer

According to the expression profile of mucosa of transverse colon, BAX is highly expressed in mucosa of transverse colon. So, it is likely that anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550 will work for Flow Cytometry with mucosa of transverse colon.

Boster Scientific Support

Answered: 2020-03-24

Question

Does A00183-Dyl550 anti-Human Bax DyLight® 550 conjugated antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-01-01

Answer

It shows on the product datasheet, A00183-Dyl550 anti-Human Bax DyLight® 550 conjugated antibody as been tested on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-01-01

Question

Is this A00183-Dyl550 anti-Human Bax DyLight® 550 conjugated antibody reactive to the isotypes of BAX?

Verified Customer

Verified customer

Asked: 2019-11-29

Answer

The immunogen of A00183-Dyl550 anti-Human Bax DyLight® 550 conjugated antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-11-29

Question

I see that the anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-09-05

Answer

You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-09-05

Question

My question regarding product A00183-Dyl550, anti-Human Bax DyLight® 550 conjugated antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-07-26

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00183-Dyl550 anti-Human Bax DyLight® 550 conjugated antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-07-26

Question

We are currently using anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550 for human tissue, and we are well pleased with the Flow Cytometry results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2019-06-28

Answer

The anti-Human Bax DyLight® 550 conjugated antibody (A00183-Dyl550) has not been validated for cross reactivity specifically with goat tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-06-28

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for mucosa of transverse colon using anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-04-17

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-04-17

Question

See attached the WB image, lot number and protocol we used for mucosa of transverse colon using anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550. Please let me know if you require anything else.

C. Anderson

Verified customer

Asked: 2019-02-22

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-02-22

Question

We have been able to see staining in human b-cell. Any tips? Is anti-Human Bax DyLight® 550 conjugated antibody supposed to stain b-cell positively?

L. Kulkarni

Verified customer

Asked: 2019-01-03

Answer

From literature b-cell does express BAX. From Uniprot.org, BAX is expressed in mucosa of transverse colon, b-cell, brain, ovarian carcinoma, skin, among other tissues. Regarding which tissues have BAX expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 8358790
Brain, Pubmed ID: 9920818
Ovarian carcinoma, Pubmed ID: 14702039
Skin, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-01-03

Question

Is there a BSA free version of anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550 available?

Verified Customer

Verified customer

Asked: 2018-09-06

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-09-06

Question

Is a blocking peptide available for product anti-Human Bax DyLight® 550 conjugated antibody (A00183-Dyl550)?

Verified Customer

Verified customer

Asked: 2018-08-22

Answer

We do provide the blocking peptide for product anti-Human Bax DyLight® 550 conjugated antibody (A00183-Dyl550). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-08-22

Question

I am interested in to test anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550 on human mucosa of transverse colon for research purposes, then I may be interested in using anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2018-02-12

Answer

The products we sell, including anti-Human Bax DyLight® 550 conjugated antibody A00183-Dyl550, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-02-12

Question

I was wanting to use your anti-Human Bax DyLight® 550 conjugated antibody for Flow Cytometry for human mucosa of transverse colon on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human mucosa of transverse colon identification?

K. Roberts

Verified customer

Asked: 2013-10-28

Answer

As indicated on the product datasheet, A00183-Dyl550 anti-Human Bax DyLight® 550 conjugated antibody has been validated for Flow Cytometry on human tissues. We have an innovator award program that if you test this antibody and show it works in human mucosa of transverse colon in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2013-10-28

Question

Our lab were content with the WB result of your anti-Human Bax DyLight® 550 conjugated antibody. However we have observed positive staining in mucosa of transverse colon isoform gamma: cytoplasm. using this antibody. Is that expected? Could you tell me where is BAX supposed to be expressed?

T. Mangal

Verified customer

Asked: 2013-09-12

Answer

From literature, mucosa of transverse colon does express BAX. Generally BAX expresses in isoform alpha: mitochondrion outer membrane, isoform beta: cytoplasm., isoform gamma: cytoplasm., isoform delta: cytoplasm. Regarding which tissues have BAX expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 8358790
Brain, Pubmed ID: 9920818
Ovarian carcinoma, Pubmed ID: 14702039
Skin, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2013-09-12

Size

Total: $515

SKU:A00183-Dyl550

Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A00183-Dyl550
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$515.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.