Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody(monoclonal, 2E7)

Boster Bio Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody (monoclonal, 2E7) catalog # M02389-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.

Product Info Summary

SKU: M02389-Dyl550
Size: 50ug/vial
Reactive Species: Human
Host: Mouse
Application: Flow Cytometry

Product Name

Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody(monoclonal, 2E7)

See all TCP1 alpha products

SKU/Catalog Number

M02389-Dyl550

Size

50ug/vial

Form

Liquid

Description

Boster Bio Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody (monoclonal, 2E7) catalog # M02389-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.

Storage & Handling

At 2-8?C for one year from date of receipt. Protect from light. Do not freeze.

Cite This Product

Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody(monoclonal, 2E7) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M02389-Dyl550)

Host

Mouse

Contents

Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.

Clonality

Monoclonal

Clone Number

2.00E+07

Isotype

IgG1

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

M02389-Dyl550 is reactive to TCP1 in Human

Applications

M02389-Dyl550 is guaranteed for Flow Cytometry Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For TCP1 (Source: Uniprot.Org, NCBI)

Uniprot ID

P17987

Gene ID

6950

Gene Name

TCP1

Full Name

T-complex protein 1 subunit alpha

Weight

60.344kDa

Superfamily

TCP-1 chaperonin family

Alternative Names

CCT1T-complex protein 1 subunit alpha; CCTa; CCT-alpha; D6S230E; tailless complex polypeptide 1; t-complex 1; T-complex protein 1, alpha subunit; TCP-1-alpha TCP1 CCT-alpha, CCT1, CCTa, D6S230E, TCP-1-alpha t-complex 1 T-complex protein 1 subunit alpha|T-complex protein 1, alpha subunit|t-complex 1 protein|tailless complex polypeptide 1

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on TCP1, check out the TCP1 Infographic

TCP1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for TCP1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for M02389-Dyl550

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody(monoclonal, 2E7)?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody(monoclonal, 2E7)

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody(monoclonal, 2E7)

Question

Is this M02389-Dyl550 anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) reactive to the isotypes of TCP1?

Verified Customer

Verified customer

Asked: 2019-06-18

Answer

The immunogen of M02389-Dyl550 anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) is A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-06-18

Question

Would anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) M02389-Dyl550 work for Flow Cytometry with testis?

R. Thomas

Verified customer

Asked: 2017-06-12

Answer

According to the expression profile of testis, TCP1 is highly expressed in testis. So, it is likely that anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) M02389-Dyl550 will work for Flow Cytometry with testis.

Boster Scientific Support

Answered: 2017-06-12

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for testis using anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) M02389-Dyl550. Let me know if you need anything else.

O. Brown

Verified customer

Asked: 2016-10-11

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-10-11

Question

I was wanting to use your anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) for Flow Cytometry for human testis on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human testis identification?

F. Bhatt

Verified customer

Asked: 2016-09-26

Answer

As indicated on the product datasheet, M02389-Dyl550 anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) has been tested for Flow Cytometry on human tissues. We have an innovator award program that if you test this antibody and show it works in human testis in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2016-09-26

Question

I am interested in to test anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) M02389-Dyl550 on human testis for research purposes, then I may be interested in using anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) M02389-Dyl550 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

K. Kulkarni

Verified customer

Asked: 2014-02-24

Answer

The products we sell, including anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) M02389-Dyl550, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2014-02-24

$330

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
M02389-Dyl550
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$330.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.