Anti-Neuropeptide Y/NPY Antibody Picoband™

Neuropeptide Y antibody

Boster Bio Anti-Neuropeptide Y/NPY Antibody Picoband™ catalog # PB9296. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 8 publication(s).

Product Info Summary

SKU: PB9296
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-Neuropeptide Y/NPY Antibody Picoband™

View all Neuropeptide Y Antibodies

SKU/Catalog Number

PB9296

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Neuropeptide Y/NPY Antibody Picoband™ catalog # PB9296. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Neuropeptide Y/NPY Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9296)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9296 is reactive to NPY in Human, Mouse, Rat

Applications

PB9296 is guaranteed for IHC, WB Boster Guarantee

Observed Molecular Weight

11 kDa

Calculated molecular weight

10.851kDa

Background of Neuropeptide Y

This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For NPY (Source: Uniprot.org, NCBI)

Gene Name

NPY

Full Name

Pro-neuropeptide Y

Weight

10.851kDa

Superfamily

NPY family

Alternative Names

170 kDa melanoma membrane-bound gelatinase; DKFZp686G13158; DPPIV; EC 3.4.21.-; FAPA; Fibroblast activation protein alpha; fibroblast activation protein, alpha; Integral membrane serine protease; Neuropeptide Y; NPY; PYY4; seprase NPY PYY4 neuropeptide Y pro-neuropeptide Y|prepro-neuropeptide Y

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on NPY, check out the NPY Infographic

NPY infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NPY: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB9296 has been cited in 8 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

An immunohistochemical study on endocrine cells in the neuroendocrine system of the digestive tract of milkfish Chanos chanos (Forsskal, 1775)

Increased inflammation promotes ventricular arrhythmia through aggravating left stellate ganglion remodeling in a canine ischemia model

Expression changes of thrombospondin-1 and neuropeptide Y in myocardium of STZ-induced rats

Different Effects of Implanting Sensory Nerve or Blood Vessel on the Vascularization, Neurotization, and Osteogenesis of Tissue-Engineered Bone In Vivo

Wang Sx, Chen Jx, Yue Gx, Bai Mh, Kou Mj, Jin Zy. Evid Based Complement Alternat Med. 2012;2012:381278. Doi: 10.1155/2012/381278. Epub 2012 Nov 13. Xiaoyaosan Decoction Regulates Changes In Neuropeptide Y And Leptin Receptor In The Rat Arcuate Nuc...

Song C, Yang Z, Zhong M, Chen Z. Neural Regen Res. 2013 Feb 25;8(6):506-13. Doi: 10.3969/J.Issn.1673-5374.2013.06.003. Sericin Protects Against Diabetes-Induced Injuries In Sciatic Nerve And Related Nerve Cells.

Wang H, Zhou N, Zhang R, Wu Y, Zhang R, Zhang S. Acta Histochem. 2014 Oct;116(8):1418-26. Doi: 10.1016/J.Acthis.2014.09.005. Epub 2014 Oct 23. Identification And Localization Of Gastrointestinal Hormones In The Skin Of The Bullfrog Rana Catesbeian...

Huang J, Zhu C, Zhang P, Zhu Q, Liu Y, Zhu Z, Wang M, Li W, Yang G, Dong N, Liu J, Chen L, Zhang Y, Yang R, Deng L, Fan J, Wang X, Liu J, Ma B, Fu Q, Wu K. Sci Rep. 2013;3:1114. Doi: 10.1038/Srep01114. Epub 2013 Jan 23. S100+ Cells: A New Neuro-Im...

Have you used Anti-Neuropeptide Y/NPY Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Neuropeptide Y/NPY Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

17 Customer Q&As for Anti-Neuropeptide Y/NPY Antibody Picoband™

Question

Do you ship PB9296 with dry ice?

Verified customer

Asked: 2022-05-16

Answer

The Anti-Neuropeptide Y/NPY Antibody Picoband™ (PB9296) does not require dry ice during shipping.

Boster Scientific Support

Answered: 2022-05-16

Question

Would anti-Neuropeptide Y/NPY antibody PB9296 work for IHC with prostate gland?

Verified Customer

Verified customer

Asked: 2019-12-10

Answer

According to the expression profile of prostate gland, NPY is highly expressed in prostate gland. So, it is likely that anti-Neuropeptide Y/NPY antibody PB9296 will work for IHC with prostate gland.

Boster Scientific Support

Answered: 2019-12-10

Question

Can you help my question with product PB9296, anti-Neuropeptide Y/NPY antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-08-09

Answer

We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9296 anti-Neuropeptide Y/NPY antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-08-09

Question

Is a blocking peptide available for product anti-Neuropeptide Y/NPY antibody (PB9296)?

Verified Customer

Verified customer

Asked: 2019-07-18

Answer

We do provide the blocking peptide for product anti-Neuropeptide Y/NPY antibody (PB9296). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-07-18

Question

We have observed staining in human prostate gland. Any tips? Is anti-Neuropeptide Y/NPY antibody supposed to stain prostate gland positively?

Verified Customer

Verified customer

Asked: 2019-07-11

Answer

According to literature prostate gland does express NPY. According to Uniprot.org, NPY is expressed in prostate gland, brain, liver, among other tissues. Regarding which tissues have NPY expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334
Liver, Pubmed ID: 24275569

Boster Scientific Support

Answered: 2019-07-11

Question

My lab would like to test anti-Neuropeptide Y/NPY antibody PB9296 on human prostate gland for research purposes, then I may be interested in using anti-Neuropeptide Y/NPY antibody PB9296 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-06-21

Answer

The products we sell, including anti-Neuropeptide Y/NPY antibody PB9296, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-06-21

Question

We are currently using anti-Neuropeptide Y/NPY antibody PB9296 for human tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2019-06-06

Answer

The anti-Neuropeptide Y/NPY antibody (PB9296) has not been validated for cross reactivity specifically with goat tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-06-06

Question

Is there a BSA free version of anti-Neuropeptide Y/NPY antibody PB9296 available?

Verified Customer

Verified customer

Asked: 2019-02-01

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Neuropeptide Y/NPY antibody PB9296 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-02-01

Question

Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for prostate gland using anti-Neuropeptide Y/NPY antibody PB9296. Let me know if you need anything else.

G. Li

Verified customer

Asked: 2018-07-03

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-07-03

Question

I see that the anti-Neuropeptide Y/NPY antibody PB9296 works with IHC, what is the protocol used to produce the result images on the product page?

E. Collins

Verified customer

Asked: 2018-04-17

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2018-04-17

Question

Our lab want to know about using your anti-Neuropeptide Y/NPY antibody for g protein-coupled receptor signaling pathway studies. Has this antibody been tested with western blotting on rat brain tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2017-07-26

Answer

We appreciate your inquiry. This PB9296 anti-Neuropeptide Y/NPY antibody is tested on mouse brain, brain tissue, rat brain tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2017-07-26

Question

Our lab were well pleased with the WB result of your anti-Neuropeptide Y/NPY antibody. However we have seen positive staining in liver secreted. using this antibody. Is that expected? Could you tell me where is NPY supposed to be expressed?

Verified Customer

Verified customer

Asked: 2017-06-21

Answer

From what I have seen in literature, liver does express NPY. Generally NPY expresses in secreted. Regarding which tissues have NPY expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334
Liver, Pubmed ID: 24275569

Boster Scientific Support

Answered: 2017-06-21

Question

See below the WB image, lot number and protocol we used for prostate gland using anti-Neuropeptide Y/NPY antibody PB9296. Please let me know if you require anything else.

C. Moore

Verified customer

Asked: 2016-05-12

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-05-12

Question

We ordered your anti-Neuropeptide Y/NPY antibody for WB on liver in the past. I am using rat, and We want to use the antibody for IHC next. I would like examining liver as well as brain in our next experiment. Do you have any suggestion on which antibody would work the best for IHC?

C. Krishna

Verified customer

Asked: 2015-01-28

Answer

I looked at the website and datasheets of our anti-Neuropeptide Y/NPY antibody and it appears that PB9296 has been tested on rat in both WB and IHC. Thus PB9296 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2015-01-28

Question

Is this PB9296 anti-Neuropeptide Y/NPY antibody reactive to the isotypes of NPY?

B. Mangal

Verified customer

Asked: 2014-11-07

Answer

The immunogen of PB9296 anti-Neuropeptide Y/NPY antibody is A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2014-11-07

Question

I was wanting to use your anti-Neuropeptide Y/NPY antibody for IHC for human prostate gland on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human prostate gland identification?

C. Jones

Verified customer

Asked: 2014-05-20

Answer

As indicated on the product datasheet, PB9296 anti-Neuropeptide Y/NPY antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human prostate gland in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2014-05-20

Question

Would PB9296 anti-Neuropeptide Y/NPY antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

E. Dhar

Verified customer

Asked: 2013-10-23

Answer

As indicated on the product datasheet, PB9296 anti-Neuropeptide Y/NPY antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2013-10-23

Order DetailsPrice
PB9296

100μg

$370
PB9296-10ug

10μg sample (liquid)

$99
PB9296-Biotin

100 μg Biotin conjugated

$570
PB9296-Cy3

100 μg Cy3 conjugated

$570
PB9296-Dylight488

100 μg Dylight488 conjugated

$570
PB9296-Dylight550

100 μg Dylight550 conjugated

$570
PB9296-Dylight594

100 μg Dylight594 conjugated

$570
PB9296-FITC

100 μg FITC conjugated

$570
PB9296-HRP

100 μg HRP conjugated

$570
PB9296-APC

100 μg APC conjugated

$670
PB9296-PE

100 μg PE conjugated

$670
PB9296-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
Eddy test
In stock
Order Product
PB9296
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.