Anti-PML Protein Antibody Picoband™

PML Protein antibody

Boster Bio Anti-PML Protein Antibody Picoband™ catalog # PB10085. Tested in IHC, WB applications. This antibody reacts with Mouse.

Product Info Summary

SKU: PB10085
Size: 100 μg/vial
Reactive Species: Mouse
Host: Rabbit
Application: IHC, WB

Product Name

Anti-PML Protein Antibody Picoband™

View all PML Protein Antibodies

SKU/Catalog Number

PB10085

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-PML Protein Antibody Picoband™ catalog # PB10085. Tested in IHC, WB applications. This antibody reacts with Mouse.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-PML Protein Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10085)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of mouse PML Protein, different from the related human sequence by six amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB10085 is reactive to PML in Mouse

Applications

PB10085 is guaranteed for IHC, WB Boster Guarantee

Observed Molecular Weight

72 kDa, 97 kDa

Calculated molecular weight

97.551kDa

Background of PML Protein

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, By Heat
Western blot, 0.1-0.5μg/ml, Mouse

Validation Images & Assay Conditions

Gene/Protein Information For PML (Source: Uniprot.org, NCBI)

Gene Name

PML

Full Name

Protein PML

Weight

97.551kDa

Alternative Names

MYLPP8675; Promyelocytic leukemia protein; promyelocytic leukemia; RING finger protein 71; RNF71probable transcription factor PML; TRIM19promyelocytic leukemia, inducer of; tripartite motif protein TRIM19; Tripartite motif-containing protein 19 PML MYL, PP8675, RNF71, TRIM19 PML nuclear body scaffold protein PML|PML/RARA fusion|RING finger protein 71|probable transcription factor PML|promyelocytic leukemia protein|promyelocytic leukemia, inducer of|tripartite motif protein TRIM19|tripartite motif-containing protein 19

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on PML, check out the PML Infographic

PML infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PML: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB10085

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-PML Protein Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-PML Protein Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-PML Protein Antibody Picoband™

Question

See attached the WB image, lot number and protocol we used for cervix carcinoma erythroleukemia using anti-PML Protein antibody PB10085. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-04-29

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-04-29

Question

Is there a BSA free version of anti-PML Protein antibody PB10085 available?

Verified Customer

Verified customer

Asked: 2019-11-26

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-PML Protein antibody PB10085 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-11-26

Question

We have seen staining in mouse liver. Do you have any suggestions? Is anti-PML Protein antibody supposed to stain liver positively?

J. Zhang

Verified customer

Asked: 2019-11-05

Answer

From literature liver does express PML. From Uniprot.org, PML is expressed in left lobe of thyroid gland, brain, kidney, cervix carcinoma, leukemic t-cell, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have PML expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 16572171
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Kidney, Pubmed ID: 15489334
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569

Boster Scientific Support

Answered: 2019-11-05

Question

I was wanting to use your anti-PML Protein antibody for IHC for mouse cervix carcinoma erythroleukemia on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse cervix carcinoma erythroleukemia identification?

Verified Customer

Verified customer

Asked: 2019-09-17

Answer

As indicated on the product datasheet, PB10085 anti-PML Protein antibody has been validated for IHC, WB on mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse cervix carcinoma erythroleukemia in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-09-17

Question

I see that the anti-PML Protein antibody PB10085 works with IHC, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-09-13

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-09-13

Question

Would anti-PML Protein antibody PB10085 work for IHC with cervix carcinoma erythroleukemia?

Verified Customer

Verified customer

Asked: 2019-05-24

Answer

According to the expression profile of cervix carcinoma erythroleukemia, PML is highly expressed in cervix carcinoma erythroleukemia. So, it is likely that anti-PML Protein antibody PB10085 will work for IHC with cervix carcinoma erythroleukemia.

Boster Scientific Support

Answered: 2019-05-24

Question

Is this PB10085 anti-PML Protein antibody reactive to the isotypes of PML?

J. Wu

Verified customer

Asked: 2019-02-13

Answer

The immunogen of PB10085 anti-PML Protein antibody is A synthetic peptide corresponding to a sequence at the N-terminus of mouse PML Protein (140-177aa LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN), different from the related human sequence by six amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-02-13

Question

I have a question about product PB10085, anti-PML Protein antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2017-11-10

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB10085 anti-PML Protein antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2017-11-10

Question

We ordered your anti-PML Protein antibody for WB on cervix carcinoma erythroleukemia in the past. I am using mouse, and We want to use the antibody for IHC next. I am looking for examining cervix carcinoma erythroleukemia as well as leukemic t-cell in our next experiment. Do you have any suggestion on which antibody would work the best for IHC?

Verified Customer

Verified customer

Asked: 2017-10-02

Answer

I have checked the website and datasheets of our anti-PML Protein antibody and it seems that PB10085 has been validated on mouse in both WB and IHC. Thus PB10085 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2017-10-02

Question

Our team were satisfied with the WB result of your anti-PML Protein antibody. However we have observed positive staining in leukemic t-cell nucleus. nucleus using this antibody. Is that expected? Could you tell me where is PML supposed to be expressed?

Verified Customer

Verified customer

Asked: 2017-06-13

Answer

According to literature, leukemic t-cell does express PML. Generally PML expresses in nucleus. nucleus, nucleoplasm. cytoplasm. Regarding which tissues have PML expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 16572171
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Kidney, Pubmed ID: 15489334
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569

Boster Scientific Support

Answered: 2017-06-13

Question

Is a blocking peptide available for product anti-PML Protein antibody (PB10085)?

Verified Customer

Verified customer

Asked: 2017-06-06

Answer

We do provide the blocking peptide for product anti-PML Protein antibody (PB10085). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2017-06-06

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for cervix carcinoma erythroleukemia using anti-PML Protein antibody PB10085. Let me know if you need anything else.

R. Jackson

Verified customer

Asked: 2015-09-02

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2015-09-02

Question

I am interested in to test anti-PML Protein antibody PB10085 on mouse cervix carcinoma erythroleukemia for research purposes, then I may be interested in using anti-PML Protein antibody PB10085 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

B. Mitchell

Verified customer

Asked: 2015-07-10

Answer

The products we sell, including anti-PML Protein antibody PB10085, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2015-07-10

Question

Will PB10085 anti-PML Protein antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

F. Jha

Verified customer

Asked: 2014-10-14

Answer

It shows on the product datasheet, PB10085 anti-PML Protein antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2014-10-14

Question

We are currently using anti-PML Protein antibody PB10085 for mouse tissue, and we are satisfied with the IHC results. The species of reactivity given in the datasheet says mouse. Is it possible that the antibody can work on bovine tissues as well?

D. Walker

Verified customer

Asked: 2013-11-25

Answer

The anti-PML Protein antibody (PB10085) has not been tested for cross reactivity specifically with bovine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2013-11-25

Order DetailsPrice
PB10085

100μg

$370
PB10085-10ug

10μg sample (liquid)

$99
PB10085-Biotin

100 μg Biotin conjugated

$570
PB10085-Cy3

100 μg Cy3 conjugated

$570
PB10085-Dylight488

100 μg Dylight488 conjugated

$570
PB10085-Dylight550

100 μg Dylight550 conjugated

$570
PB10085-Dylight594

100 μg Dylight594 conjugated

$570
PB10085-FITC

100 μg FITC conjugated

$570
PB10085-HRP

100 μg HRP conjugated

$570
PB10085-APC

100 μg APC conjugated

$670
PB10085-PE

100 μg PE conjugated

$670
PB10085-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
Eddy test
In stock
Order Product
PB10085
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.