Product Info Summary
SKU: | PB10085 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Mouse |
Host: | Rabbit |
Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-PML Protein Antibody Picoband™
View all PML Protein Antibodies
SKU/Catalog Number
PB10085
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-PML Protein Antibody Picoband™ catalog # PB10085. Tested in IHC, WB applications. This antibody reacts with Mouse.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-PML Protein Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10085)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of mouse PML Protein, different from the related human sequence by six amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB10085 is reactive to PML in Mouse
Applications
PB10085 is guaranteed for IHC, WB Boster Guarantee
Observed Molecular Weight
72 kDa, 97 kDa
Calculated molecular weight
97.551kDa
Background of PML Protein
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, By Heat
Western blot, 0.1-0.5μg/ml, Mouse
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of PML Protein using anti-PML Protein antibody (PB10085).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: mouse testis tissue lysates,
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PML Protein antigen affinity purified polyclonal antibody (Catalog # PB10085) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for PML Protein at approximately 72 kDa, 97 kDa. The expected band size for PML Protein is at 98 kDa.
Click image to see more details
Figure 2. IHC analysis of PML Protein using anti-PML Protein antibody (PB10085).
PML Protein was detected in a paraffin-embedded section of mouse spleen tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-PML Protein Antibody (PB10085) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For PML (Source: Uniprot.org, NCBI)
Gene Name
PML
Full Name
Protein PML
Weight
97.551kDa
Alternative Names
MYLPP8675; Promyelocytic leukemia protein; promyelocytic leukemia; RING finger protein 71; RNF71probable transcription factor PML; TRIM19promyelocytic leukemia, inducer of; tripartite motif protein TRIM19; Tripartite motif-containing protein 19 PML MYL, PP8675, RNF71, TRIM19 PML nuclear body scaffold protein PML|PML/RARA fusion|RING finger protein 71|probable transcription factor PML|promyelocytic leukemia protein|promyelocytic leukemia, inducer of|tripartite motif protein TRIM19|tripartite motif-containing protein 19
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on PML, check out the PML Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for PML: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-PML Protein Antibody Picoband™ (PB10085)
Hello CJ!
No publications found for PB10085
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-PML Protein Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-PML Protein Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-PML Protein Antibody Picoband™
Question
See attached the WB image, lot number and protocol we used for cervix carcinoma erythroleukemia using anti-PML Protein antibody PB10085. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-04-29
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-04-29
Question
Is there a BSA free version of anti-PML Protein antibody PB10085 available?
Verified Customer
Verified customer
Asked: 2019-11-26
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-PML Protein antibody PB10085 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-11-26
Question
We have seen staining in mouse liver. Do you have any suggestions? Is anti-PML Protein antibody supposed to stain liver positively?
J. Zhang
Verified customer
Asked: 2019-11-05
Answer
From literature liver does express PML. From Uniprot.org, PML is expressed in left lobe of thyroid gland, brain, kidney, cervix carcinoma, leukemic t-cell, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have PML expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 16572171
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Kidney, Pubmed ID: 15489334
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Boster Scientific Support
Answered: 2019-11-05
Question
I was wanting to use your anti-PML Protein antibody for IHC for mouse cervix carcinoma erythroleukemia on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse cervix carcinoma erythroleukemia identification?
Verified Customer
Verified customer
Asked: 2019-09-17
Answer
As indicated on the product datasheet, PB10085 anti-PML Protein antibody has been validated for IHC, WB on mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse cervix carcinoma erythroleukemia in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-09-17
Question
I see that the anti-PML Protein antibody PB10085 works with IHC, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-09-13
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-09-13
Question
Would anti-PML Protein antibody PB10085 work for IHC with cervix carcinoma erythroleukemia?
Verified Customer
Verified customer
Asked: 2019-05-24
Answer
According to the expression profile of cervix carcinoma erythroleukemia, PML is highly expressed in cervix carcinoma erythroleukemia. So, it is likely that anti-PML Protein antibody PB10085 will work for IHC with cervix carcinoma erythroleukemia.
Boster Scientific Support
Answered: 2019-05-24
Question
Is this PB10085 anti-PML Protein antibody reactive to the isotypes of PML?
J. Wu
Verified customer
Asked: 2019-02-13
Answer
The immunogen of PB10085 anti-PML Protein antibody is A synthetic peptide corresponding to a sequence at the N-terminus of mouse PML Protein (140-177aa LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN), different from the related human sequence by six amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-02-13
Question
I have a question about product PB10085, anti-PML Protein antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2017-11-10
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB10085 anti-PML Protein antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2017-11-10
Question
We ordered your anti-PML Protein antibody for WB on cervix carcinoma erythroleukemia in the past. I am using mouse, and We want to use the antibody for IHC next. I am looking for examining cervix carcinoma erythroleukemia as well as leukemic t-cell in our next experiment. Do you have any suggestion on which antibody would work the best for IHC?
Verified Customer
Verified customer
Asked: 2017-10-02
Answer
I have checked the website and datasheets of our anti-PML Protein antibody and it seems that PB10085 has been validated on mouse in both WB and IHC. Thus PB10085 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2017-10-02
Question
Our team were satisfied with the WB result of your anti-PML Protein antibody. However we have observed positive staining in leukemic t-cell nucleus. nucleus using this antibody. Is that expected? Could you tell me where is PML supposed to be expressed?
Verified Customer
Verified customer
Asked: 2017-06-13
Answer
According to literature, leukemic t-cell does express PML. Generally PML expresses in nucleus. nucleus, nucleoplasm. cytoplasm. Regarding which tissues have PML expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 16572171
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Kidney, Pubmed ID: 15489334
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Boster Scientific Support
Answered: 2017-06-13
Question
Is a blocking peptide available for product anti-PML Protein antibody (PB10085)?
Verified Customer
Verified customer
Asked: 2017-06-06
Answer
We do provide the blocking peptide for product anti-PML Protein antibody (PB10085). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2017-06-06
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for cervix carcinoma erythroleukemia using anti-PML Protein antibody PB10085. Let me know if you need anything else.
R. Jackson
Verified customer
Asked: 2015-09-02
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2015-09-02
Question
I am interested in to test anti-PML Protein antibody PB10085 on mouse cervix carcinoma erythroleukemia for research purposes, then I may be interested in using anti-PML Protein antibody PB10085 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
B. Mitchell
Verified customer
Asked: 2015-07-10
Answer
The products we sell, including anti-PML Protein antibody PB10085, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2015-07-10
Question
Will PB10085 anti-PML Protein antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
F. Jha
Verified customer
Asked: 2014-10-14
Answer
It shows on the product datasheet, PB10085 anti-PML Protein antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2014-10-14
Question
We are currently using anti-PML Protein antibody PB10085 for mouse tissue, and we are satisfied with the IHC results. The species of reactivity given in the datasheet says mouse. Is it possible that the antibody can work on bovine tissues as well?
D. Walker
Verified customer
Asked: 2013-11-25
Answer
The anti-PML Protein antibody (PB10085) has not been tested for cross reactivity specifically with bovine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2013-11-25