Show Order Info
Pack Size:100μg/vial
Validated Species:Human, Mouse, Rat
Application:IHC, WB
Data & Images


Product Name Anti-RAB13 Picoband™ Antibody
SKU/Catalog Number PB9790
Description Rabbit IgG polyclonal antibody for Ras-related protein Rab-13(RAB13) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Cite This Product Anti-RAB13 Picoband™ Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9790)
Replacement Item This antibody may replace the following items: sc-56182|sc-99|sc-98|sc-53396|sc-53397|sc-1314|sc-1312|sc-65226|sc-6243|sc-374087|sc-47698|sc-53394|sc-17846|sc-55476|sc-263|sc-73566|sc-81168|sc-56180|sc-65334|sc-136023|sc-71821|sc-71820|sc-71818|sc-71819|sc-71817|sc-17577|sc-17578|sc-25767|sc-1313|sc-100|sc-74573|sc-1315|sc-74574|sc-126|sc-393031|sc-6243-G|sc-56179|sc-71815|sc-98-X|sc-6243-X|sc-126-X|sc-1311-R|sc-71817-X|sc-1315-X from Santa Cruz Biotechnology.
Host Rabbit
Validated Species Human, Mouse, Rat
Predicted Species Hamster

*This antibody is predicted to react with the above species based on antigen sequence similarities. Our Boster Guarantee covers the use of this product with the above species.

Application IHC, WB

*Our Boster Guarantee covers the use of this product in the above tested applications.

**For positive and negative control design, consult "Tissue specificity" under Protein Target Info.

Recommended Detection Systems Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
*Blocking peptide can be purchased at $50. Contact us for more information
**Boster also offers various secondary antibodies for Immunoflourescecne and IHC. Take advantage of the buy 1 primary antibody get 1 secondary antibody for free promotion for the entire year 2018!
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human RAB13 (121-150aa NKCDMEAKRKVQKEQADKLAREHGIRFFET), different from the related mouse and rat sequences by four amino acids.
Cross Reactivity No cross reactivity with other proteins.
Pack Size 100μg/vial


Clonality Polyclonal
Form Lyophilized
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Purification Immunogen affinity purified.
Isotype N/A

Protein Target Info (Source:

You can check the tissue specificity below for information on selecting positive and negative control.

Gene Name RAB13
Protein Name Ras-related protein Rab-13
Molecular Weight 22774 MW
Protein Function The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is involved in endocytic recycling and regulates the transport to the plasma membrane of transmembrane proteins like the tight junction protein OCLN/occludin. Thereby, it regulates the assembly and the activity of tight junctions. Moreover, it may also regulate tight junction assembly by activating the PKA signaling pathway and by reorganizing the actin cytoskeleton through the activation of the downstream effectors PRKACA and MICALL2 respectively. Through its role in tight junction assembly, may play a role in the establishment of Sertoli cell barrier. Plays also a role in angiogenesis through regulation of endothelial cells chemotaxis. Also involved in neurite outgrowth. Has also been proposed to play a role in post-Golgi membrane trafficking from the TGN to the recycling endosome. Finally, it has been involved in insulin- induced transport to the plasma membrane of the glucose transporter GLUT4 and therefore may play a role in glucose homeostasis. .
Tissue Specificity Detected in several types of epithelia, including intestine, kidney, liver and in endothelial cells.
Subcellular Localization Cell membrane ; Lipid-anchor ; Cytoplasmic side . Cytoplasmic vesicle membrane ; Lipid- anchor ; Cytoplasmic side . Cell junction, tight junction . Golgi apparatus, trans-Golgi network membrane . Recycling endosome membrane . Cell projection, lamellipodium . Tight junctions or associated with vesicles scattered throughout the cytoplasm in cells lacking tight junctions (PubMed:8294494). Relocalizes to the leading edge of lamellipodia in migrating endothelial cells (By similarity). .
Uniprot ID P51153
Alternative Names Ras-related protein Rab-13;Cell growth-inhibiting gene 4 protein;RAB13;GIG4;
Research Areas |signal transduction|signaling pathway|g protein signaling|small g proteins|ras family| signal transduction|cytoskeleton / ecm|cell adhesion|tight junctions|
*if product is indicated to react with multiple species, protein info is based on the human gene.

Background for Ras-related protein Rab-13

Ras-related protein Rab-13 is a protein that in humans is encoded by the RAB13 gene. This gene is a member of the Rab family of small G proteins and plays a role in regulating membrane trafficking between trans-Golgi network (TGN) and recycling endosomes (RE). The encoded protein is involved in the assembly of tight junctions, which are components of the apical junctional complex (AJC) of epithelial cells. The AJC plays a role in forming a barrier between luminal contents and the underlying tissue. Additional functions associated with the protein include endocytic recycling of occludin, regulation of epithelial cell scattering, neuronal regeneration and regulation of neurite outgrowth. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 12.

Anti-RAB13 Picoband™ Antibody Images

Click the images to enlarge.

Anti-RAB13 Picoband™ Antibody
Anti- RAB13 Picoband antibody, PB9790, Western blotting
All lanes: Anti RAB13 (PB9790) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Lane 3: HEPG2 Whole Cell Lysate at 40ug
Predicted bind size: 23KD, 45KD
Observed bind size: 23KD, 45KD
Anti-RAB13 Picoband™ Antibody
Anti- RAB13 Picoband antibody, PB9790, IHC(P)
IHC(P): Mouse Intestine Tissue
Anti-RAB13 Picoband™ Antibody
Anti- RAB13 Picoband antibody, PB9790, IHC(P)
IHC(P): Rat Intestine Tissue
Write a review for PB9790

Customer Q&As

Q: Do you offer BSA-free antibodies? Keyword: Bovine serum albumin, carrier protein, conjugation
A: Yes, please contact us at for more information about BSA-free antibodies and availability. The new BSA-free formula uses trehalose as a replacement to BSA. We have tested many alternative chemicals and found that trehalose protects the antibodies the best.
Q: Can I conjugate markers to this antibody? Can I link custom conjugates to this antibody? Keyword: conjugation
A: The antibody is stored with BSA and cannot be conjugated with markers. Carrier free antibodies are available upon request. Please contact
Q: What should I use for negative control?
A: Please contact us for negative control suggestions. You can also check expression databases such as genecards, uniprot etc. Due to logistic reasons, we do not sell serum or lysates that we use internally for positive or negative control.
Q: Where can I find troubleshooting information? What should I do if I have unexpected bands, high background, no signal, weak signal
A: You can find Boster's troubleshoot guides under tech support tab. Please contact us for further assistance on troubleshooting your experiment.
Q: What is the immunogen sequence of this antibody? Is this antibody polyclonal or monoclonal?
A: You can find the immunogen sequence under "Immunogen" and clonality in the product name.
Q: What is the expected band size? Why is it different than the observed band size?
A: The expected band size is predicted on the size of the protein. The actual band size may be affected by a few other factors including but not limited to:
1. Post-translational modification:phosphorylation, methylation, glycosylation etc. These modifications prevent SDS molecules from binding to the target protein and thus make the band size appear larger than expected
2. Post-translational cleavage: this can cause smaller bands and or multiple bands

3. Alternative splicing: the same gene can have alternative splicing patterns generating different size proteins, all with reactivities to the antibody.

4. Amino Acid R chain charge: SDS binds to positive charges. The different size and charge of the Amino Acid side chains can affect the amount of SDS binding and thus affect the observed band size.
5. Multimers: Multimers are usually broken up in reducing conditions. However if the interactions between the multimers are strong, the band may appear higher.,
Q: What is the suggested dilution ratio for Western Blot (WB), Immunohistochemistry (IHC) and or ELISA standards? What is the optimal pH for the sample?
A: Check the datasheet for the product for details on dilution ratios for different experiments. You can find the datasheet button on the right side of the product page.
Q: What is the protocol you used for your Western blotting (WB) and Immunohistochemistry (IHC)?
A: Check our protocols under the tech support tab.