SKU PB9790
Size 100μg/vial
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Ig Isotype N/A
Applications IHC, WB


Product Name Anti-RAB13 Picoband™ Antibody
SKU/Catalog Number PB9790
Storage & Handling At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Size 100μg/vial
Description Rabbit IgG polyclonal antibody for Ras-related protein Rab-13(RAB13) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Cite This Product Anti-RAB13 Picoband™ Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9790)
Host Rabbit
Contents/Buffer Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Form Lyophilized
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human RAB13 (121-150aa NKCDMEAKRKVQKEQADKLAREHGIRFFET), different from the related mouse and rat sequences by four amino acids.
Reactivity Human, Mouse, Rat

Assay Details

Assay Dilutions Overview

Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunohistochemistry(Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human, Rat

Boster's Secondary Antibodies And IHC, WB Kits

The following reagents are used to generate the images below.

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Images And Assay Conditions

/antibody/pb9790 1_1 WB anti rab13 picoband antibody.jpg

Anti- RAB13 Picoband antibody, PB9790, Western blotting
All lanes: Anti RAB13 (PB9790) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Lane 3: HEPG2 Whole Cell Lysate at 40ug
Predicted bind size: 23KD, 45KD
Observed bind size: 23KD, 45KD

/antibody/pb9790 2_1 IHC anti rab13 picoband antibody.jpg

Anti- RAB13 Picoband antibody, PB9790, IHC(P)
IHC(P): Mouse Intestine Tissue

/antibody/pb9790 3_1 IHC anti rab13 picoband antibody.jpg

Anti- RAB13 Picoband antibody, PB9790, IHC(P)
IHC(P): Rat Intestine Tissue

Target Info

Protein Target Info (Source:

Uniprot Id P51153
Gene Name RAB13
Protein Name Ras-related protein Rab-13
Tissue Specificity Detected in several types of epithelia, including intestine, kidney, liver and in endothelial cells.
Alternative Names Ras-related protein Rab-13;Cell growth-inhibiting gene 4 protein;RAB13;GIG4;
Subcellular Localization Cell membrane ; Lipid-anchor ; Cytoplasmic side . Cytoplasmic vesicle membrane ; Lipid- anchor ; Cytoplasmic side . Cell junction, tight junction . Golgi apparatus, trans-Golgi network membrane . Recycling endosome membrane . Cell projection, lamellipodium . Tight junctions or associated with vesicles scattered throughout the cytoplasm in cells lacking tight junctions (PubMed:8294494). Relocalizes to the leading edge of lamellipodia in migrating endothelial cells (By similarity). .
Molecular Weight 22774 MW

*if product is indicated to react with multiple species, protein info is based on the human gene.


Protein Function The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is involved in endocytic recycling and regulates the transport to the plasma membrane of transmembrane proteins like the tight junction protein OCLN/occludin. Thereby, it regulates the assembly and the activity of tight junctions. Moreover, it may also regulate tight junction assembly by activating the PKA signaling pathway and by reorganizing the actin cytoskeleton through the activation of the downstream effectors PRKACA and MICALL2 respectively. Through its role in tight junction assembly, may play a role in the establishment of Sertoli cell barrier. Plays also a role in angiogenesis through regulation of endothelial cells chemotaxis. Also involved in neurite outgrowth. Has also been proposed to play a role in post-Golgi membrane trafficking from the TGN to the recycling endosome. Finally, it has been involved in insulin- induced transport to the plasma membrane of the glucose transporter GLUT4 and therefore may play a role in glucose homeostasis. .
Research Areas Cell Adhesion, Cytoskeleton / Ecm, G Protein Signaling, Ras Family, Signal Transduction, Signaling Pathway, Small G Proteins, Tight Junctions

*You can search these to find other products in these research areas.
Background Ras-related protein Rab-13 is a protein that in humans is encoded by the RAB13 gene. This gene is a member of the Rab family of small G proteins and plays a role in regulating membrane trafficking between trans-Golgi network (TGN) and recycling endosomes (RE). The encoded protein is involved in the assembly of tight junctions, which are components of the apical junctional complex (AJC) of epithelial cells. The AJC plays a role in forming a barrier between luminal contents and the underlying tissue. Additional functions associated with the protein include endocytic recycling of occludin, regulation of epithelial cell scattering, neuronal regeneration and regulation of neurite outgrowth. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 12.

Other Recommended Resources

Here are featured tools and databases that you might find useful.

Order Product (PB9790)


Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.

$50 fee for conjugation. Antibody size is reduced to 50ug.

Option Price
30ug sample size $99
100ug $280
100ug+Free HRP Secondary BA1054 $280
100ug+Free Biotin Secondary BA1003 $280

USD $280

Ships in 7-10 business days.


Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

We promise all of our products perform as described in datasheets.

Write a review for PB9790

Customer Q&As

Q: Do you offer BSA-free antibodies? Keyword: Bovine serum albumin, carrier protein, conjugation
A: Yes, please contact us at for more information about BSA-free antibodies and availability. The new BSA-free formula uses trehalose as a replacement to BSA. We have tested many alternative chemicals and found that trehalose protects the antibodies the best.
Q: Can I conjugate markers to this antibody? Can I link custom conjugates to this antibody? Keyword: conjugation
A: The antibody is stored with BSA and cannot be conjugated with markers. Carrier free antibodies are available upon request. Please contact
Q: What should I use for negative control?
A: Please contact us for negative control suggestions. You can also check expression databases such as genecards, uniprot etc. Due to logistic reasons, we do not sell serum or lysates that we use internally for positive or negative control.
Q: Where can I find troubleshooting information? What should I do if I have unexpected bands, high background, no signal, weak signal
A: You can find Boster's troubleshoot guides under tech support tab. Please contact us for further assistance on troubleshooting your experiment.
Q: What is the immunogen sequence of this antibody? Is this antibody polyclonal or monoclonal?
A: You can find the immunogen sequence under "Immunogen" and clonality in the product name.
Q: What is the expected band size? Why is it different than the observed band size?
A: The expected band size is predicted on the size of the protein. The actual band size may be affected by a few other factors including but not limited to:
1. Post-translational modification:phosphorylation, methylation, glycosylation etc. These modifications prevent SDS molecules from binding to the target protein and thus make the band size appear larger than expected
2. Post-translational cleavage: this can cause smaller bands and or multiple bands

3. Alternative splicing: the same gene can have alternative splicing patterns generating different size proteins, all with reactivities to the antibody.

4. Amino Acid R chain charge: SDS binds to positive charges. The different size and charge of the Amino Acid side chains can affect the amount of SDS binding and thus affect the observed band size.
5. Multimers: Multimers are usually broken up in reducing conditions. However if the interactions between the multimers are strong, the band may appear higher.,
Q: What is the suggested dilution ratio for Western Blot (WB), Immunohistochemistry (IHC) and or ELISA standards? What is the optimal pH for the sample?
A: Check the datasheet for the product for details on dilution ratios for different experiments. You can find the datasheet button on the right side of the product page.
Q: What is the protocol you used for your Western blotting (WB) and Immunohistochemistry (IHC)?
A: Check our protocols under the tech support tab.