Show Order Info
SKU:PB9157
Pack Size:100μg/vial
Sample Size:30ug for $99, contact us for details
Clonality:Polyclonal
Application:IHC-P, WB
Price: $240.00
Quantity:
Technical
Specs
Kit
Components
Gene
Information
Application
Data & Images
Reviews
Publications
FAQs

Overview

Product Name Anti-RUNX1/AML1 Picoband™ Antibody
SKU/Catalog Number PB9157
Description Rabbit IgG polyclonal antibody for Runt-related transcription factor 1(RUNX1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Cite This Product Anti-RUNX1/AML1 Picoband™ Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9157)
Replacement Item This antibody may replace the following items: sc-8563|sc-28679|sc-101146|sc-8564|sc-365644|sc-28679-X|sc-8564-X|sc-365644-X|sc-8563-X from Santa Cruz Biotechnology.
Host Rabbit
Isotype N/A
Validated Species Human, Mouse, Rat
Predicted Species Hamster

*This antibody is predicted to react with the above species based on antigen sequence similarities. Our Boster Guarantee covers the use of this product with the above species.

Application IHC-P, WB

*Our Boster Guarantee covers the use of this product in the above tested applications.

**For positive and negative control design, consult "Tissue specificity" under Protein Target Info.

Recommended Detection Systems Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
*Blocking peptide can be purchased at $50. Contact us for more information
**Boster also offers various secondary antibodies for Immunoflourescecne and IHC. Take advantage of the buy 1 primary antibody get 1 secondary antibody for free promotion for the entire year 2017!
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human RUNX1(200-233aa ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN), identical to the related mouse and rat sequences.
Cross Reactivity No cross reactivity with other proteins
Pack Size 100μg/vial

Properties

Clonality Polyclonal
Form Lyophilized
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
*carrier free antibody available upon request.
Concentration Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Purification Immunogen affinity purified.
Isotype N/A

Protein Target Info (Source: Uniprot.org)

You can check the tissue specificity below for information on selecting positive and negative control.

Gene Name RUNX1
Protein Name Runt-related transcription factor 1
Molecular Weight 48737 MW
Protein Function CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL-3 and GM-CSF promoters. The alpha subunit binds DNA and appears to have a role in the development of normal hematopoiesis. Isoform AML-1L interferes with the transactivation activity of RUNX1. Acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the mouse BLK promoter. Inhibits KAT6B- dependent transcriptional activation. Controls the anergy and suppressive function of regulatory T-cells (Treg) by associating with FOXP3. Activates the expression of IL2 and IFNG and down- regulates the expression of TNFRSF18, IL2RA and CTLA4, in conventional T-cells (PubMed:17377532). .
Tissue Specificity Expressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood.
Sequence Similarities Contains 1 Runt domain.
Subcellular Localization Nucleus.
Uniprot ID Q01196
Alternative Names Runt-related transcription factor 1;Acute myeloid leukemia 1 protein;Core-binding factor subunit alpha-2;CBF-alpha-2;Oncogene AML-1;Polyomavirus enhancer-binding protein 2 alpha B subunit;PEA2-alpha B;PEBP2-alpha B;SL3-3 enhancer factor 1 alpha B subunit;SL3/AKV core-binding factor alpha B subunit;RUNX1;AML1, CBFA2;
Research Areas |neuroscience|neurology process|neurogenesis| epigenetics and nuclear signaling|transcription|other factors| stem cells|hematopoietic progenitors|intracellular molecules|transcription factors|chromatin binding proteins|dna / rna binding|mesenchymal stem cells|osteogenesis| cancer|oncoproteins/suppressors|oncoproteins|hemangioblast| developmental biology|organogenesis|hematopoietic system development|skeletal development|bone|
*if product is indicated to react with multiple species, protein info is based on the human gene.

Background for Runt-related transcription factor 1

Runt-related transcription factor 1 (RUNX1), also known as AML1 or CBFA2, is a protein that in humans is encoded by the RUNX1 gene. It belongs to the Runt-related transcription factor (RUNX) family of genes which are also called core binding factor-α (CBFα). RUNX1 is mapped to 21q22.12. RUNX1 is a transcription factor that regulates the differentiation of hematopoietic stem cells into mature blood cells. RUNX proteins form a heterodimeric complex with CBFβ which confers increased DNA binding and stability to the complex. Chromosomal translocations involving the RUNX1 gene are associated with several types of leukemia including M2 AML. Mutations in RUNX1 are implicated in cases of breast cancer.

Anti-RUNX1/AML1 Picoband™ Antibody Images

Click the images to enlarge.

Anti-RUNX1/AML1 Picoband™ Antibody
Anti-RUNX1/AML1 Picoband antibody , PB9157-1.jpg
All lanes: Anti RUNX1 (PB9157) at 0.5ug/ml
WB: Recombinant Human RUNX1 Protein 0.5ng
Predicted bind size: 50KD
Observed bind size: 50KD
Anti-RUNX1/AML1 Picoband™ Antibody
Anti-RUNX1/AML1 Picoband antibody , PB9157-2.JPG
IHC(P): Rat Thymus Tissue
Anti-RUNX1/AML1 Picoband™ Antibody
Anti-RUNX1/AML1 Picoband antibody , PB9157-3.JPG
IHC(P): Human Mammary Cancer Tissue
Anti-RUNX1/AML1 Picoband™ Antibody
Anti-RUNX1/AML1 Picoband antibody , PB9157-4.JPG
IHC(P): Mouse Intestine Tissue
Write a review for PB9157

Publications

Du B, Li L, Zhong Z, Fan X, Qiao B, He C, Fu Z, Wang Y, Ye Q. Int J Mol Med. 2014 Aug;34(2):578-84. Doi: 10.3892/Ijmm.2014.1806. Epub 2014 Jun 16. Brain Death Induces The Alteration Of Liver Protein Expression Profiles In Rabbits.

FAQs

Q: Do you offer BSA-free antibodies? Keyword: Bovine serum albumin, carrier protein, conjugation
A: Yes, please contact us at support@bosterbio.com for more information about BSA-free antibodies and availability. The new BSA-free formula uses trehalose as a replacement to BSA. We have tested many alternative chemicals and found that trehalose protects the antibodies the best.
Q: Can I conjugate markers to this antibody? Can I link custom conjugates to this antibody? Keyword: conjugation
A: The antibody is stored with BSA and cannot be conjugated with markers. Carrier free antibodies are available upon request. Please contact support@bosterbio.com
Q: What should I use for negative control?
A: Please contact us for negative control suggestions. You can also check expression databases such as genecards, uniprot etc. Due to logistic reasons, we do not sell serum or lysates that we use internally for positive or negative control.
Q: Where can I find troubleshooting information? What should I do if I have unexpected bands, high background, no signal, weak signal
A: You can find Boster's troubleshoot guides under tech support tab. Please contact us for further assistance on troubleshooting your experiment.
Q: What is the immunogen sequence of this antibody? Is this antibody polyclonal or monoclonal?
A: You can find the immunogen sequence under "Immunogen" and clonality in the product name.
Q: What is the expected band size? Why is it different than the observed band size?
A: The expected band size is predicted on the size of the protein. The actual band size may be affected by a few other factors including but not limited to:
1. Post-translational modification:phosphorylation, methylation, glycosylation etc. These modifications prevent SDS molecules from binding to the target protein and thus make the band size appear larger than expected
2. Post-translational cleavage: this can cause smaller bands and or multiple bands

3. Alternative splicing: the same gene can have alternative splicing patterns generating different size proteins, all with reactivities to the antibody.

4. Amino Acid R chain charge: SDS binds to positive charges. The different size and charge of the Amino Acid side chains can affect the amount of SDS binding and thus affect the observed band size.
5. Multimers: Multimers are usually broken up in reducing conditions. However if the interactions between the multimers are strong, the band may appear higher.,
Q: What is the suggested dilution ratio for Western Blot (WB), Immunohistochemistry (IHC) and or ELISA standards? What is the optimal pH for the sample?
A: Check the datasheet for the product for details on dilution ratios for different experiments. You can find the datasheet button on the right side of the product page.
Q: What is the protocol you used for your Western blotting (WB) and Immunohistochemistry (IHC)?
A: Check our protocols under the tech support tab.
Q: What are some alternative names that could be used to describe this product?
A: Some common names include but are not limited to runx1 antibody, aml1 antibody, evi1 antibody