Product Info Summary
SKU: | A02917-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | Flow Cytometry, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-TUB 1 Antibody Picoband™
SKU/Catalog Number
A02917-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-TUB 1 Antibody Picoband™ catalog # A02917-1. Tested in Flow Cytometry, WB applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-TUB 1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02917-1)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human TUB 1, different from the related mouse and rat sequences by one amino acid.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A02917-1 is reactive to TUB in Human
Applications
A02917-1 is guaranteed for Flow Cytometry, WB Boster Guarantee
Observed Molecular Weight
62 kDa
Calculated molecular weight
55.651kDa
Background of Tubby
Tubby protein homolog is a protein that in humans is encoded by the TUB gene. This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of TUB 1 using anti-TUB 1 antibody (A02917-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human COLO320 whole cell lysates,
Lane 2: human MCF-7 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-TUB 1 antigen affinity purified polyclonal antibody (Catalog # A02917-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for TUB 1 at approximately 62 kDa.
Click image to see more details
Figure 2. Flow Cytometry analysis of HeLa cells using anti-TUB 1 antibody (A02917-1).
Overlay histogram showing HeLa cells stained with A02917-1 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-TUB 1 Antibody (A02917-1,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For TUB (Source: Uniprot.org, NCBI)
Gene Name
TUB
Full Name
Tubby protein homolog
Weight
55.651kDa
Superfamily
TUB family
Alternative Names
RD5; RDOB; tubby (mouse) homolog; tubby homolog (mouse); Tubby Homolog; tubby homologue; tubby protein homolog; Tubby TUB RDOB, rd5 TUB bipartite transcription factor tubby protein homolog|tubby bipartite transcription factor|tubby homolog|tubby homologue
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on TUB, check out the TUB Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for TUB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-TUB 1 Antibody Picoband™ (A02917-1)
Hello CJ!
No publications found for A02917-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-TUB 1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-TUB 1 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-TUB 1 Antibody Picoband™
Question
Is this A02917-1 anti-TUB 1 antibody reactive to the isotypes of TUB?
Verified Customer
Verified customer
Asked: 2019-09-13
Answer
The immunogen of A02917-1 anti-TUB 1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human TUB 1 (395-429aa VHERVSIRPRNEHETLLARWQNKNTESIIELQNKT), different from the related mouse and rat sequences by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-09-13
Question
I was wanting to use to test anti-TUB 1 antibody A02917-1 on human fetal brain for research purposes, then I may be interested in using anti-TUB 1 antibody A02917-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-07-22
Answer
The products we sell, including anti-TUB 1 antibody A02917-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-07-22
Question
We are currently using anti-TUB 1 antibody A02917-1 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on zebrafish tissues as well?
Verified Customer
Verified customer
Asked: 2017-08-09
Answer
The anti-TUB 1 antibody (A02917-1) has not been validated for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-08-09
Question
I was wanting to use your anti-TUB 1 antibody for WB for human fetal brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human fetal brain identification?
S. Edwards
Verified customer
Asked: 2014-02-27
Answer
As indicated on the product datasheet, A02917-1 anti-TUB 1 antibody has been validated for Flow Cytometry, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human fetal brain in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2014-02-27