Pack Size:100μl
Validated Species:Human, Mouse, Rat
Immunogen:Peptide sequence around phosphorylation site of threonine 183 (M-M-T(p)-P-Y) derived from Human SAPK/JNK.
Clonality:Polyclonal
Application:IHC, WB

Availability: Ships in 5-7 business days

Pack Size:100ug/vial
Validated Species:Human, Mouse, Rat
Immunogen:A synthesized peptide derived from human JNK1+JNK2+JNK3
Clonality:Monoclonal
Clone Number:DFI-13
Application:IP, IF, ICC, WB

Availability: Ships in 5-7 business days

Pack Size:100ug/vial
Validated Species:Human, Mouse, Rat
Immunogen:A synthesized peptide derived from human JNK1/JNK3
Clonality:Monoclonal
Clone Number:ICC-13
Application:IP, WB

Availability: Ships in 5-7 business days

Pack Size:100ug/vial
Validated Species:Human, Mouse, Rat
Immunogen:A synthesized peptide derived from human JNK3
Clonality:Monoclonal
Clone Number:HGC-13
Application:Flow Cytometry, IF, ICC, WB

Availability: Ships in 5-7 business days

Pack Size:100ug/vial
Validated Species:Human, Mouse, Rat
Immunogen:A synthesized peptide derived from human JNK2
Clonality:Monoclonal
Clone Number:EIF-13
Application:Flow Cytometry, IP, IF, IHC, ICC, WB

Availability: Ships in 5-7 business days

Pack Size:100ug
Validated Species:Human, Mouse, Rat
Immunogen:A synthesized peptide derived from human Phospho-JNK1/2/3 (T183+T183+T221) Phospho-JNK1/2/3 (T183+T183+T221) Antibody will detect will detect JNK1 (pT183), JNK2 (pT183) and JNK3 (pT221) .
Clonality:Monoclonal
Clone Number:EAG-13
Application:Flow Cytometry, IP, IF, IHC, WB

Availability: Ships in 5-7 business days

Pack Size:100µg
Validated Species:Human
Immunogen:Synthetic peptide corresponding to the sequence near the N-terminus of Jnk3.
Clonality:Monoclonal 4G6
Application:IHC, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Mouse, Rat
Immunogen:A synthetic peptide corresponding to a sequence at the N-terminus of human JNK1(1-15aa MSRSKRDNNFYSVEI), identical to the related rat and mouse sequences.
Clonality:Polyclonal
Application:WB
Availability: Ships next business day
Pack Size:100μg/vial
Validated Species:Human
Immunogen:A synthetic peptide corresponding to a sequence in the middle region of human JNK2 (257-288aa RNYVENRPKYPGIKFEELFPDWIFPSESERDK), identical to the related mouse and rat sequences.
Clonality:Polyclonal
Application:WB

Availability: Ships in 5-7 business days

Available Sizes:1ug, 5ug, 200ug
Applications:ex vivo Cell Culture
Source:E. Coli
Purity:Greater than 95% as determined by SDS-PAGE.

Availability: Ships in 5-7 business days

Page 1 of 3
items
  1. 1
  2. 2
  3. 3