Pack Size:96wells/kit, with removable strips.
Validated Species:Human
Immunogen:Expression system for standard: NSO; Immunogen sequence: S61-Q273
Application:ELISA
Sensitivity:<10pg/ml
Assay Range:31.2pg/ml-2000pg/ml
Sample Type:cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).
Availability: Ships next business day
Pack Size:96wells/kit, with removable strips.
Validated Species:Mouse
Immunogen:Expression system for standard: NSO; Immunogen sequence: R60-I363
Application:ELISA
Sensitivity:<1pg/ml
Assay Range:31.2pg/ml-2000pg/ml
Sample Type:cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).
Availability: Ships next business day
Pack Size:For 5 plates, 96 wells each
Validated Species:Human
Immunogen:Expression system for standard: NSO; Immunogen sequence: S61-Q273
Application:ELISA
Sensitivity:<10pg/ml
Assay Range:31.2pg/ml-2000pg/ml
Sample Type:cell culture supernates, cell lysates, tissue homogenates, serum and plasma (heparin, EDTA).

Availability: Ships in 5-7 business days

Pack Size:100ug/vial
Validated Species:Human
Immunogen:A synthetic peptide corresponding to a sequence in the middle region of human LOX-1/OLR1 (162-197aa SFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISY), different from the related rat sequence by thirteen amino acids.
Clonality:Polyclonal
Application:WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Rat
Immunogen:A synthetic peptide corresponding to a sequence in the middle region of human LOX 1(114-127aa NEKSKEQMELHHQN), different from the related rat sequence by three amino acids.
Clonality:Polyclonal
Application:WB
Availability: Ships next business day
Pack Size:100μg/vial
Validated Species:Human
Immunogen:A synthetic peptide corresponding to a sequence at the N-terminus of human LOX 1(1-16aa MTFDDLKIQTVKDQPD).
Clonality:Polyclonal
Application:WB
Availability: Ships next business day
Page 1 of 1
items