Pack Size:96wells/kit, with removable strips.
Validated Species:Human
Immunogen:Expression system for standard: NSO; Immunogen sequence: L20-C471
Application:ELISA
Sensitivity:<5pg/ml
Assay Range:156pg/ml-10000pg/ml
Sample Type:cell culture supernates, serum and plasma( heparin).
Availability: Ships next business day
Pack Size:100μg/vial
Validated Species:Human, Mouse, Rat
Immunogen:E. coli-derived rat MMP13 recombinant protein (Position: Y99-H335).
Clonality:Polyclonal
Application:ELISA, IHC, WB

Availability: Ships in 5-7 business days

Pack Size:100ug/vial
Validated Species:Human, Mouse
Immunogen:A synthesized peptide derived from human MMP13
Clonality:Monoclonal
Application:WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human
Immunogen:A synthetic peptide corresponding to a sequence at the N-terminus of human MMP13 (109-154aa RTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFT), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino aci
Clonality:Polyclonal
Application:WB

Availability: Ships in 5-7 business days

Page 1 of 1
items