Pack Size:96wells/kit, with removable strips.
Validated Species:Human
Immunogen:Expression system for standard: NSO,A105-L250
Application:ELISA
Sensitivity:<10pg/ml
Assay Range:156pg/ml-10,000pg/ml
Sample Type:cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).
Availability: Ships next business day
Pack Size:For 5 plates, 96 wells each
Validated Species:Human
Immunogen:Expression system for standard: NSO,A105-L250
Application:ELISA
Sensitivity:<10pg/ml
Assay Range:156pg/ml-10,000pg/ml
Sample Type:cell culture supernates, cell lysates, tissue homogenates, serum and plasma (heparin, EDTA).
Availability: Ships next business day
Pack Size:96wells/kit, with removable strips.
Validated Species:Monkey
Immunogen:Expression system for standard: NSO,A105-L250
Application:ELISA
Sensitivity:<10pg/ml
Assay Range:156pg/ml-10,000pg/ml
Sample Type:cell culture supernates, serum and plasma(heparin, EDTA).
Availability: Ships next business day
Pack Size:100μg/vial
Validated Species:Human
Immunogen:A synthetic peptide corresponding to a sequence in the middle region of human APRIL (122-151aa PINATSKDDSDVTEVMWQPALRRGRGLQAQ), different from the related mouse sequence by five amino acids.
Clonality:Polyclonal
Application:ELISA, WB

Availability: Ships in 5-7 business days

Page 1 of 1
items