Pack Size:100ug/vial
Validated Species:Human
Immunogen:Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).
Clonality:Mouse Monoclonal Antibody [Clone DG1/447 + DOG-1.1]
Clone Number:Clone DG1/447 + DOG-1.1
Application:IF, IHC

Availability: Ships in 5-7 business days

Available Sizes:2ug, 5ug, 10ug
Applications:ex vivo Cell Culture
Source:Dog Heart.
Purity:Greater than 90% as determined by SDS-PAGE.

Availability: Ships in 5-7 business days

Available Sizes:20ug, 100ug, 1mg
Applications:ex vivo Cell Culture
Source:E. Coli
Purity:Greater than 98.0% as determined by:
(a) Analysis by SEC-HPLC.
(b) Analysis by SDS-PAGE.

Availability: Ships in 5-7 business days

Available Sizes:2ug, 10ug, 1mg
Applications:ex vivo Cell Culture
Source:E. Coli
Purity:Greater than 97.0% as determined by:(a) Analysis by HPLC.(b) Analysis by SDS-PAGE.

Availability: Ships in 5-7 business days

Pack Size:96wells/kit, with removable strips.
Validated Species:Canine
Immunogen:Expression system for standard: sf21; Immunogen sequence: H129-R247
Application:ELISA
Sensitivity:<15pg/ml
Assay Range:31.2pg/ml-2000pg/ml
Sample Type:cell culture supernates, serum and plasma(heparin, EDTA, citrate).
Availability: Ships next business day
Pack Size:96wells/kit, with removable strips.
Validated Species:Canine
Immunogen:Expression system for standard: sf21; Immunogen sequence: Y139-T257
Application:ELISA
Sensitivity:<2pg/ml
Assay Range:15.6pg/ml-1000pg/ml
Sample Type:cell culture supernates and serum.
Availability: Ships next business day
Pack Size:96wells/kit, with removable strips.
Validated Species:Canine
Immunogen:Expression system for standard: CHO; Immunogen sequence: A279-S390
Application:ELISA
Sensitivity:<1pg/ml
Assay Range:15.6pg/ml-1000pg/ml
Sample Type:cell culture supernates, serum, plasma(EDTA) and urine.

Availability: Ships in 5-7 business days

Pack Size:96wells/kit, with removable strips.
Validated Species:Canine
Immunogen:Expression system for standard: NSO; Immunogen sequence: G20-T200
Application:ELISA
Sensitivity:<10pg/ml
Assay Range:62.5pg/ml-4000pg/ml
Sample Type:cell culture supernates, serum and plasma(heparin, EDTA).

Availability: Ships in 5-7 business days

Pack Size:96wells/kit, with removable strips.
Validated Species:Canine
Immunogen:Expression system for standard: human peptide; Immunogen sequence: C53-W73
Application:ELISA
Sensitivity:<0.5pg/ml
Assay Range:3.9pg/ml-250pg/ml
Sample Type:cell culture supernates, serum and plasma(heparin, EDTA).

Availability: Ships in 5-7 business days

Pack Size:96wells/kit, with removable strips.
Validated Species:Canine
Immunogen:Expression system for standard: sf21; Immunogen sequence: A301-S412
Application:ELISA
Sensitivity:<10pg/ml
Assay Range:31.2pg/ml-2000pg/ml
Sample Type:cell culture supernates, serum, plasma(EDTA) and urine.
Availability: Ships next business day
Page 1 of 9
items
  1. 1
  2. 2
  3. 3
  4. ...
  5. 9