Anti-DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Monoclonal Antibody M30940
$299.00
| Pack Size: | 100ug/vial |
|---|---|
| Validated Species: | Human |
| Immunogen: | Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). |
| Clonality: | Mouse Monoclonal Antibody [Clone DG1/447 + DOG-1.1] |
| Clone Number: | Clone DG1/447 + DOG-1.1 |
| Application: | IF, IHC |
| Availability: |
Ships in 5-7 business days
|
|---|
| Available Sizes: | 2ug, 5ug, 10ug |
|---|---|
| Applications: | ex vivo Cell Culture |
| Source: | Dog Heart. |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Availability: |
Ships in 5-7 business days
|
|---|
| Available Sizes: | 20ug, 100ug, 1mg |
|---|---|
| Applications: | ex vivo Cell Culture |
| Source: | E. Coli |
| Purity: | Greater than 98.0% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE. |
| Availability: |
Ships in 5-7 business days
|
|---|
| Available Sizes: | 2ug, 10ug, 1mg |
|---|---|
| Applications: | ex vivo Cell Culture |
| Source: | E. Coli |
| Purity: | Greater than 97.0% as determined by:(a) Analysis by HPLC.(b) Analysis by SDS-PAGE. |
| Availability: |
Ships in 5-7 business days
|
|---|
| Pack Size: | 96wells/kit, with removable strips. |
|---|---|
| Validated Species: | Canine |
| Immunogen: | Expression system for standard: sf21; Immunogen sequence: H129-R247 |
| Application: | ELISA |
| Sensitivity: | <15pg/ml |
| Assay Range: | 31.2pg/ml-2000pg/ml |
| Sample Type: | cell culture supernates, serum and plasma(heparin, EDTA, citrate). |
| Availability: |
Ships next business day
|
|---|
| Pack Size: | 96wells/kit, with removable strips. |
|---|---|
| Validated Species: | Canine |
| Immunogen: | Expression system for standard: sf21; Immunogen sequence: Y139-T257 |
| Application: | ELISA |
| Sensitivity: | <2pg/ml |
| Assay Range: | 15.6pg/ml-1000pg/ml |
| Sample Type: | cell culture supernates and serum. |
| Availability: |
Ships next business day
|
|---|
| Pack Size: | 96wells/kit, with removable strips. |
|---|---|
| Validated Species: | Canine |
| Immunogen: | Expression system for standard: CHO; Immunogen sequence: A279-S390 |
| Application: | ELISA |
| Sensitivity: | <1pg/ml |
| Assay Range: | 15.6pg/ml-1000pg/ml |
| Sample Type: | cell culture supernates, serum, plasma(EDTA) and urine. |
| Availability: |
Ships in 5-7 business days
|
|---|
| Pack Size: | 96wells/kit, with removable strips. |
|---|---|
| Validated Species: | Canine |
| Immunogen: | Expression system for standard: NSO; Immunogen sequence: G20-T200 |
| Application: | ELISA |
| Sensitivity: | <10pg/ml |
| Assay Range: | 62.5pg/ml-4000pg/ml |
| Sample Type: | cell culture supernates, serum and plasma(heparin, EDTA). |
| Availability: |
Ships in 5-7 business days
|
|---|
| Pack Size: | 96wells/kit, with removable strips. |
|---|---|
| Validated Species: | Canine |
| Immunogen: | Expression system for standard: human peptide; Immunogen sequence: C53-W73 |
| Application: | ELISA |
| Sensitivity: | <0.5pg/ml |
| Assay Range: | 3.9pg/ml-250pg/ml |
| Sample Type: | cell culture supernates, serum and plasma(heparin, EDTA). |
| Availability: |
Ships in 5-7 business days
|
|---|
| Pack Size: | 96wells/kit, with removable strips. |
|---|---|
| Validated Species: | Canine |
| Immunogen: | Expression system for standard: sf21; Immunogen sequence: A301-S412 |
| Application: | ELISA |
| Sensitivity: | <10pg/ml |
| Assay Range: | 31.2pg/ml-2000pg/ml |
| Sample Type: | cell culture supernates, serum, plasma(EDTA) and urine. |
| Availability: |
Ships next business day
|
|---|
