Pack Size:100μg/vial
Validated Species:Human, Monkey, Mouse, Rat
Immunogen:A synthetic peptide corresponding to a sequence of human FH (YDKAAKIAKTAH KNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK).
Clonality:Monoclonal
Clone Number:9D8
Application:IHC-P, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Monkey, Mouse, Rat
Immunogen:E. coli-derived human PPID recombinant protein (Position: N306-A370).
Clonality:Monoclonal
Clone Number:5A6
Application:Flow Cytometry, IHC-P, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Monkey, Mouse, Rat
Immunogen:A synthetic peptide corresponding to a sequence in the middle region of human Calpastatin (275-310aa QEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLR), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by eleven amino acids.
Clonality:Monoclonal
Clone Number:14E12
Application:IHC-P, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Monkey, Mouse
Immunogen:A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.
Clonality:Monoclonal
Clone Number:4B4
Application:IHC-P, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Monkey, Mouse
Immunogen:E. coli-derived human Calpain 2 recombinant protein (Position: R500-L700). Human Calpain 2 shares 93.5% and 92.5% amino acid (aa) sequence identity with mouse and rat Calpain 2, respectively.
Clonality:Monoclonal
Clone Number:8I6
Application:Flow Cytometry, IHC-P, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Monkey, Mouse
Immunogen:A synthetic peptide corresponding to a sequence at the C-terminus of human RPA70 (533-568aa QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR), different from the related mouse sequence by three amino acids.
Clonality:Monoclonal
Clone Number:5E5
Application:Flow Cytometry, IHC-P, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Monkey
Immunogen:E.coli-derived human Beta 2 Microglobulin recombinant protein (Position: Q22-M119). Human Beta 2 Microglobulin shares 69.4% and 74.5% amino acid (aa) sequence identity with mouse and rat Beta 2 Microglobulin, respectively.
Clonality:Monoclonal
Clone Number:2H10
Application:Flow Cytometry, IHC-P, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Monkey, Mouse, Rat
Immunogen:E.coli-derived human STAT1 recombinant protein (Position: S2-A230). Human STAT1 shares 91.2% amino acid (aa) sequence identity with mouse STAT1.
Clonality:Polyclonal
Application:IHC, WB

Availability: Ships in 5-7 business days

Pack Size:100ug/vial
Validated Species:Human, Monkey, Mouse, Rat
Immunogen:E. coli-derived human beta Catenin recombinant protein (Position: A2-K233).
Clonality:Polyclonal
Application:ELISA, IHC, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Monkey, Mouse, Rat
Predicted Species:Hamster
Clonality:Polyclonal
Application:IHC-P, WB
Availability: Ships next business day
Page 1 of 17
items
  1. 1
  2. 2
  3. 3
  4. ...
  5. 17