Pack Size:100μg/vial
Validated Species:Human, Mouse, Rat
Immunogen:E.coli-derived human Cytochrome C recombinant protein (Position: G2-E105). Human Cytochrome C shares 91% amino acid (aa) sequence identity with both mouse and rat Cytochrome C.
Clonality:Monoclonal
Clone Number:15F10
Application:Flow Cytometry, IHC-P, IHC-F, ICC, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Mouse, Rat
Immunogen:A synthetic peptide corresponding to a sequence of human GSTM1 (EEEKIRVDIL ENQTMDNHMQLGMICYNPEFEKLK).
Clonality:Monoclonal
Clone Number:11F2
Application:Flow Cytometry, IHC-P, IHC-F, ICC, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Mouse, Rat
Immunogen:A synthetic peptide corresponding to a sequence at the C-terminus of human RbAp48 (395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS), identical to the related mouse sequence.
Clonality:Monoclonal
Clone Number:9F3
Application:IHC-P, WB
Availability: Ships next business day
Pack Size:100μg/vial
Validated Species:Human, Mouse, Rat
Immunogen:A synthetic peptide corresponding to a sequence at the C-terminus of human SMC3 (1178-1216aa ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH), identical to the related mouse sequence.
Clonality:Monoclonal
Clone Number:4C12
Application:IHC-P, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Mouse, Rat
Immunogen:A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences.
Clonality:Monoclonal
Clone Number:4A4
Application:IHC-P, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Mouse, Rat
Immunogen:A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
Clonality:Monoclonal
Clone Number:3H5
Application:Flow Cytometry, IHC-P, IHC-F, ICC, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Mouse, Rat
Immunogen:E. coli-derived human CD2AP recombinant protein (Position: K253-K337).
Clonality:Monoclonal
Clone Number:5F8
Application:Flow Cytometry, IHC-P, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Mouse, Rat
Immunogen:E. coli-derived human beta Catenin recombinant protein (Position: A2-K233).
Clonality:Monoclonal
Clone Number:1F6
Application:Flow Cytometry, IHC-P, ICC, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Monkey, Mouse, Rat
Immunogen:E. coli-derived human PPID recombinant protein (Position: N306-A370).
Clonality:Monoclonal
Clone Number:5A6
Application:Flow Cytometry, IHC-P, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Monkey, Mouse, Rat
Immunogen:A synthetic peptide corresponding to a sequence of human FH (YDKAAKIAKTAH KNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK).
Clonality:Monoclonal
Clone Number:9D8
Application:IHC-P, WB

Availability: Ships in 5-7 business days

Page 1 of 304
items
  1. 1
  2. 2
  3. 3
  4. ...
  5. 304