IL-1-beta Interleukin-1 beta Rat Recombinant Protein

IL-1 beta/IL-1F2 protein, Rat

Interleukin-1b Rat Recombinant produced in E. coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa. The IL-1b is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTQ63264
Size: 2ug, 10ug, 1mg
Origin Species: Rat
Source: Escherichia coli

Product Name

IL-1-beta Interleukin-1 beta Rat Recombinant Protein

View all IL-1 beta/IL-1F2 recombinant proteins

SKU/Catalog Number

PROTQ63264

Size

2ug, 10ug, 1mg

Description

Interleukin-1b Rat Recombinant produced in E. coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa. The IL-1b is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Cite This Product

IL-1-beta Interleukin-1 beta Rat Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ63264)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4.

Purity

Greater than 97.0% as determined by SDS-PAGE.

Predicted MW

30.748kDa

Reconstitution

It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Amino Acid Sequence

MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSF VQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKK KMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRD IVDFTMEPVSS

Biological Activity

The ED50 was found to be less than 0.1ng/ml, determined by the dose dependent proliferation of mouse D10S cells, corresponding to a specific activity of 10,000,000 units/mg.

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconstitution

It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Validation Images & Assay Conditions

Gene/Protein Information For IL1B (Source: Uniprot.org, NCBI)

Gene Name

IL1B

Full Name

Interleukin-1 beta

Weight

30.748kDa

Superfamily

IL-1 family

Alternative Names

catabolin; IL1 beta; IL-1 beta; IL-1; IL1B; IL-1b; IL1-BETA; IL-1F2; IL1F2IL-1 beta; interleukin 1, beta; interleukin-1 beta; preinterleukin 1 beta; pro-interleukin-1-beta IL1B IL-1, IL1-BETA, IL1F2, IL1beta interleukin 1 beta interleukin-1 beta|IL-1 beta|catabolin|interleukin 1beta|preinterleukin 1 beta|pro-interleukin-1-beta

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IL1B, check out the IL1B Infographic

IL1B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IL1B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ63264

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used IL-1-beta Interleukin-1 beta Rat Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review IL-1-beta Interleukin-1 beta Rat Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for IL-1-beta Interleukin-1 beta Rat Recombinant Protein

Size

Total: $250

SKU:PROTQ63264

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
Eddy test
In stock
Order Product
PROTQ63264
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.