IP-10 Human Recombinant Protein (CXCL10)

IP-10 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.6kDa.
The IP-10 is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTP02778
Size: 5ug, 25ug, 1mg
Origin Species: Mouse
Source: E. Coli
Application: Cell Culture

Product Name

IP-10 Human Recombinant Protein (CXCL10)

See all CXCL10/IP-10/CRG-2 products

SKU/Catalog Number

PROTP02778

Size

5ug, 25ug, 1mg

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Description

IP-10 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.6kDa.
The IP-10 is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL10 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Cite This Product

IP-10 Human Recombinant Protein (CXCL10) (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP02778)

Formulation

Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).

Predicted MW

10.881kDa

Amino Acid Sequence

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKEMSKRSP.

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For CXCL10 (Source: Uniprot.Org, NCBI)

Uniprot ID

P02778

Gene ID

3627

Gene Name

CXCL10

Full Name

C-X-C motif chemokine 10

Weight

10.881kDa

Superfamily

intercrine alpha (chemokine CxC) family

Alternative Names

C7; chemokine (C-X-C motif) ligand 10; CRG2; CRG-2; CXCL10; gIP-10; IFI10; INP10; IP-10; mob-1; SCYB10 CXCL10 C7, IFI10, INP10, IP-10, SCYB10, crg-2, gIP-10, mob-1 C-X-C motif chemokine ligand 10 C-X-C motif chemokine 10|10 kDa interferon gamma-induced protein|gamma IP10|interferon-inducible cytokine IP-10|protein 10 from interferon (gamma)-induced cell line|small inducible cytokine subfamily B (Cys-X-Cys), member 10|small-inducible cytokine B10

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on CXCL10, check out the CXCL10 Infographic

CXCL10 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for CXCL10: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PROTP02778

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used IP-10 Human Recombinant Protein (CXCL10)?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review IP-10 Human Recombinant Protein (CXCL10)

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

2 Customer Q&As for IP-10 Human Recombinant Protein (CXCL10)

Question

What is the difference with proteins with the same name but different SKU number?

Verified customer

Asked: 2019-11-25

Answer

They differ in the amino acid sequence used and the biological activity may have been tested.

Boster Scientific Support

Answered: 2019-11-26

Question

Is protein biologically active on IP-10 Human Recombinant Protein?

Verified customer

Asked: 2019-11-25

Answer

Only some of our recombinant protein has been tested and those would have a biological activity section mentioned in https://www.bosterbio.com/datasheet?sku=PROTP02778. If there is no biological activity section mentioned in our data sheet it means that we have not assessed the bio-functionality of the protein to date. So, we cannot guarantee that the protein is biologically active.

Boster Scientific Support

Answered: 2019-11-26

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

In stock
Order Product
PROTP02778
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.