Product Info Summary
SKU: | PROTP02778 |
---|---|
Size: | 5ug, 25ug, 1mg |
Origin Species: | Human |
Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
IP-10 Human Recombinant Protein (CXCL10)
View all CXCL10/IP-10/CRG-2 recombinant proteins
SKU/Catalog Number
PROTP02778
Size
5ug, 25ug, 1mg
Description
IP-10 Human Recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.6kDa. The IP-10 is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL10 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Cite This Product
IP-10 Human Recombinant Protein (CXCL10) (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP02778)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Purity
Greater than 95.0% as determined by SDS-PAGE.
Predicted MW
10.881kDa
Reconstitution
It is recommended to reconstitute the lyophilized IP-10 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKERSKRSP
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized IP-10 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For CXCL10 (Source: Uniprot.org, NCBI)
Gene Name
CXCL10
Full Name
C-X-C motif chemokine 10
Weight
10.881kDa
Superfamily
intercrine alpha (chemokine CxC) family
Alternative Names
C7; chemokine (C-X-C motif) ligand 10; CRG2; CRG-2; CXCL10; gIP-10; IFI10; INP10; IP-10; mob-1; SCYB10 CXCL10 C7, IFI10, INP10, IP-10, SCYB10, crg-2, gIP-10, mob-1 C-X-C motif chemokine ligand 10 C-X-C motif chemokine 10|10 kDa interferon gamma-induced protein|gamma IP10|interferon-inducible cytokine IP-10|protein 10 from interferon (gamma)-induced cell line|small inducible cytokine subfamily B (Cys-X-Cys), member 10|small-inducible cytokine B10
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on CXCL10, check out the CXCL10 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CXCL10: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For IP-10 Human Recombinant Protein (CXCL10) (PROTP02778)
Hello CJ!
No publications found for PROTP02778
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used IP-10 Human Recombinant Protein (CXCL10)?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review IP-10 Human Recombinant Protein (CXCL10)
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
1 Customer Q&As for IP-10 Human Recombinant Protein (CXCL10)
Question
Is PROTP02778 biologically active?
Verified customer
Asked: 2019-11-25
Answer
Only some of our recombinant protein has been tested and those would have a biological activity section mentioned in https://www.bosterbio.com/datasheet?sku=PROTP02778. If there is no biological activity section mentioned in our data sheet it means that we have not assessed the bio-functionality of the protein to date. So, we cannot guarantee that the protein is biologically active.
Boster Scientific Support
Answered: 2019-11-26