RORC RAR-Related Orphan Receptor C Human Recombinant Protein

RAR-Related Orphan Receptor C Human Recombinant produced in E.Coli is a full length protein consisting of 497 amino acids having a molecular weight of 55.8kDa and fused with 5.5kDa amino-terminal His-Flag tag.
RORC is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTP51449
Size: 5ug, 20ug, 1mg
Origin Species: Mouse
Source: E. Coli
Application: Cell Culture

Product Name

RORC RAR-Related Orphan Receptor C Human Recombinant Protein

See all RORC products

SKU/Catalog Number

PROTP51449

Size

5ug, 20ug, 1mg

Form

Sterile filtered colorless solution.

Description

RAR-Related Orphan Receptor C Human Recombinant produced in E.Coli is a full length protein consisting of 497 amino acids having a molecular weight of 55.8kDa and fused with 5.5kDa amino-terminal His-Flag tag.
RORC is purified by proprietary chromatographic techniques.

Storage & Handling

Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.

Cite This Product

RORC RAR-Related Orphan Receptor C Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP51449)

Formulation

RORC protein is supplied in 50mM Tris, 150mM NaCl and 10% Glycerol, pH 7.5.

Predicted MW

58.195kDa

Amino Acid Sequence

MSYYHHHHHHDYDIPTTDYKDDDDKDYKDDDDKENLYFQGEFMRTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK.

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For RORC (Source: Uniprot.Org, NCBI)

Uniprot ID

P51449

Gene ID

6097

Gene Name

RORC

Full Name

Nuclear receptor ROR-gamma

Weight

58.195kDa

Superfamily

nuclear hormone receptor family

Alternative Names

ROR gamma; MGC129539; NR1F3; Nuclear receptor ROR gamma; Nuclear receptor ROR-gamma; Nuclear receptor RZR gamma; Nuclear receptor RZR-gamma; Nuclear receptor subfamily 1 group F member 3; RAR-Related Orphan Nuclear Receptor Variant 2; RAR-related orphan receptor C; RAR-related orphan receptor gamma; retinoic acid-binding receptor gamma; retinoid-related orphan receptor gamma; Retinoid-related orphan receptor-gamma; ROR gamma; RORC; RORG; RORGMGC129539; RZRG; RZRGRZR-GAMMA; TOR RORC IMD42, NR1F3, RORG, RZR-GAMMA, RZRG, TOR RAR related orphan receptor C nuclear receptor ROR-gamma|RAR-related orphan nuclear receptor variant 2|nuclear receptor RZR-gamma|nuclear receptor subfamily 1 group F member 3|retinoic acid-binding receptor gamma|retinoid-related orphan receptor gamma

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on RORC, check out the RORC Infographic

RORC infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for RORC: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PROTP51449

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RORC RAR-Related Orphan Receptor C Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review RORC RAR-Related Orphan Receptor C Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RORC RAR-Related Orphan Receptor C Human Recombinant Protein

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

In stock
Order Product
PROTP51449
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.