Human recombinant CXCL10 (C-X-C motif chemokine 10) protein, AF

CXCL10 protein, Human

C-X-C motif chemokine 10 (CXCL10) also named Interferon gamma-induced protein 10 (IP-10), which is a chemokine of the intercrine alpha family. CXCL10 is a 8.55kDa protein containing 77 amino acid residues. CXCL10 is produced by the several cell types like monocytes and endothelial cells, which are responded for IFNγ. CXCL10 is a chemotaxis for T cells, NK cells and macrophages. CXCL10 also binds the CXCR3 that induce the cell migration and activation like T cells and dendritic cells.

Product Info Summary

SKU: PROTP02778-3
Size: 5ug,20ug,100ug
Origin Species: Human
Source: Escherichia coli
Application: Cell Culture
Designing a Western blot for CXCL10? The guide covers the expected band size, antibodies backed by real blot images, the controls to run alongside, and protocols taken from published papers.
Open the CXCL10 Western Blot Guide

Product Name

Human recombinant CXCL10 (C-X-C motif chemokine 10) protein, AF

View all CXCL10 recombinant proteins

SKU/Catalog Number

PROTP02778-3

Size

5ug,20ug,100ug

Tag

His Tag (N-term)

Description

C-X-C motif chemokine 10 (CXCL10) also named Interferon gamma-induced protein 10 (IP-10), which is a chemokine of the intercrine alpha family. CXCL10 is a 8.55kDa protein containing 77 amino acid residues. CXCL10 is produced by the several cell types like monocytes and endothelial cells, which are responded for IFNγ. CXCL10 is a chemotaxis for T cells, NK cells and macrophages. CXCL10 also binds the CXCR3 that induce the cell migration and activation like T cells and dendritic cells.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Human recombinant CXCL10 (C-X-C motif chemokine 10) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP02778-3)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

10.9 kDa

Molecular weight

The protein has a calculated MW of 9.45 kDa. The protein migrates as 9-11 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to chemoattract human PBMCs using a concentration range of 10.0 - 100.0 ng/mL. Note: Results may vary from different PBMC donors.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP with polyhistidine tag at the N-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Human recombinant CXCL10 (C-X-C motif chemokine 10) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Human recombinant CXCL10 (C-X-C motif chemokine 10) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Human recombinant CXCL10 (C-X-C motif chemokine 10) protein, AF

Size

Total: $77.00

SKU:PROTP02778-3

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP02778-3
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Sep 2, 2026