Click image to see more details
Product Info Summary
| SKU: | PROTP01579-9 |
|---|---|
| Size: | 20ug,100ug,500ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Product info
Product Name
Human recombinant IFN gamma (Interferon gamma) protein, AF
View all IFNG recombinant proteins
SKU/Catalog Number
PROTP01579-9
Size
20ug,100ug,500ug
Tag
His Tag (C-term)
Description
The cytokine IFN gamma could protect cells from viral infections and belongs to the family of interferons. A lot of studies have shown that IFN gamma secreted by antigen triggered cell types, including T cells, naive CD4+ T cells, macrophages, dendritic cells, and B cells. IFN gamma plays an important role to trigger the macrophage act against a diverse group of microbial targets, and the pleiotropic molecule associated with antiproliferative, pro-apoptotic and antitumor mechanisms. Based on the effector cytokine considered as a major effector of immunity, it has been used in the treatment of several diseases.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant IFN gamma (Interferon gamma) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01579-9)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
19.3 kDa
Molecular weight
The protein has a calculated MW of 17.7 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce cytotoxicity in HT29 cells. The ED₅₀ for this effect is <1 ng/mL. The specific activity of recombinant human IFN gamma is approximately >2 x 10⁶ IU/mg.
Endotoxin
<0.01 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human IFN gamma
Specific Publications For Human recombinant IFN gamma (Interferon gamma) protein, AF (PROTP01579-9)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant IFN gamma (Interferon gamma) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant IFN gamma (Interferon gamma) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
