Click image to see more details
Product Info Summary
| SKU: | PROTQ96PD4-7 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Product info
Product Name
Human recombinant IL-17F (Interleukin-17F) protein, AF
View all IL17F recombinant proteins
SKU/Catalog Number
PROTQ96PD4-7
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Interleukin 17F (IL-17F) predicts a molecular mass of 30.1 kDa, is a cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity. It is involved in the development of inflammation and host defense against infection by inducing the expression of genes that encode other proinflammatory cytokines, such as tumor necrosis factor, interleukin 1, interleukin 6 and some members of the colony-stimulating factor family.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant IL-17F (Interleukin-17F) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96PD4-7)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium acetate, pH 4.0. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
18.0 kDa
Molecular weight
The protein has a calculated MW of 15.84 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED₅₀ for this effect is <20 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human IL-17F
Specific Publications For Human recombinant IL-17F (Interleukin-17F) protein, AF (PROTQ96PD4-7)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant IL-17F (Interleukin-17F) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant IL-17F (Interleukin-17F) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
