Product Info Summary
| SKU: | PROTP18340-1 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Product info
Product Name
Mouse recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF
View all Cxcl9 recombinant proteins
SKU/Catalog Number
PROTP18340-1
Size
5ug,20ug,100ug
Tag
His Tag (N-term)
Description
C-X-C motif chemokine 9 (CXCL9) also named monokine induced by gamma interferon (MIG), which is a chemokine of the intercrine alpha family. CXCL9 is a 11.7 kDa protein containing 10? amino acid residues. CXCL9 controls the immune cells by binding the CXCR3 which is including the cell migration and activation. During inflammation, CXCL9 is a chemotaxis for lymphocyte and macrophages. CXCL9 is participated in the process of tumor proliferation and metastasis.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP18340-1)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
14.4 kDa
Molecular weight
The protein has a calculated MW of 13.00 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to chemoattract BaF3 cells transfected with mouse CXCR3. The ED₅₀ for this effect is <0.3 μg/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKINQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse CXCL9
Specific Publications For Mouse recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF (PROTP18340-1)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question

