Swine recombinant IL-10 (Interleukin-10) protein, AF

IL10 protein, Swine

Interleukin 10 (IL-10) is a 17.54 kDa cytokine with 158 amino acid residues and is also known as human cytokine synthesis inhibitory factor (CSIF). IL-10 is an anti-inflammatory cytokine that is mainly secreted from monocytes, lymphocytes, and mast cells. IL-10 participates in the survival, proliferation, and antibody production of B cell via the JAK-STAT signaling pathway and suppress pro-inflammatory cytokine secretion by blocking the NF-κB signaling pathway.

Product Info Summary

SKU: PROTQ29055
Size: 5ug,20ug
Origin Species: Swine
Source: Escherichia coli
Application: Cell Culture

Product Name

Swine recombinant IL-10 (Interleukin-10) protein, AF

View all IL10 recombinant proteins

SKU/Catalog Number

PROTQ29055

Size

5ug,20ug

Tag

His Tag (C-term)

Description

Interleukin 10 (IL-10) is a 17.54 kDa cytokine with 158 amino acid residues and is also known as human cytokine synthesis inhibitory factor (CSIF). IL-10 is an anti-inflammatory cytokine that is mainly secreted from monocytes, lymphocytes, and mast cells. IL-10 participates in the survival, proliferation, and antibody production of B cell via the JAK-STAT signaling pathway and suppress pro-inflammatory cytokine secretion by blocking the NF-κB signaling pathway.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Swine recombinant IL-10 (Interleukin-10) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ29055)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Molecular weight

The protein has a calculated MW of 19.05 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce proliferation in MC/9‑2 cells. The ED₅₀ for this effect is <5 ng/mL.

Endotoxin

<0.01 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MSIKSENSCIHFPTSLPHMLRELRAAFGPVKSFFQTKDQMGDLLLTGSLLEDFKGYLGCQALSEMIQFYLEDVMPKAESDGEDIKEHVNSLGEKLKTLRLRLRRCHQFLPCENKSKAVEEVKSAFSKLQERGVYKAMGEFDIFINYIEAYMTMKMRKN with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Swine recombinant IL-10 (Interleukin-10) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Swine recombinant IL-10 (Interleukin-10) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Swine recombinant IL-10 (Interleukin-10) protein, AF

Size

Total: $154.00

SKU:PROTQ29055

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTQ29055
$154.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: May 20, 2026