ABHD12B (NM_181533) Human Recombinant Protein

ABHD12B protein,

Product Info Summary

SKU: PROTQ7Z5M8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ABHD12B (NM_181533) Human Recombinant Protein

View all ABHD12B recombinant proteins

SKU/Catalog Number

PROTQ7Z5M8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human abhydrolase domain containing 12B (ABHD12B), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

ABHD12B (NM_181533) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ7Z5M8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

40.776kDa

Amino Acid Sequence

MLGIWHTVPSCRGEDAKGKDCCWYEAALRDGNPIIVYLHGSAEHRAASHRLKLVKVLSDGGFHVLSVDYRGFGDSTGKPTEEGLTTDAICVYEWTKARSGITPVCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIIFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQWS

Validation Images & Assay Conditions

Gene/Protein Information For ABHD12B (Source: Uniprot.org, NCBI)

Gene Name

ABHD12B

Full Name

Protein ABHD12B

Weight

40.776kDa

Superfamily

serine esterase family

Alternative Names

abhydrolase domain containing 12B; abhydrolase domain-containing protein 12B; BEM46L3; c14_5314; C14orf29; chromosome 14 open reading frame 29; EC 3.-; MGC129926; MGC129927 ABHD12B BEM46L3, C14orf29, c14_5314 abhydrolase domain containing 12B protein ABHD12B|abhydrolase domain-containing protein 12B|alpha/beta hydrolase domain-containing protein 12B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ABHD12B, check out the ABHD12B Infographic

ABHD12B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ABHD12B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ7Z5M8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ABHD12B (NM_181533) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ABHD12B (NM_181533) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ABHD12B (NM_181533) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ7Z5M8
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.