ABO (NM_020469) Human Recombinant Protein

ABO protein,

Product Info Summary

SKU: PROTP16442
Size: 20 µg
Source: HEK293T

Product Name

ABO (NM_020469) Human Recombinant Protein

View all ABO recombinant proteins

SKU/Catalog Number

PROTP16442

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase) (ABO)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

ABO (NM_020469) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP16442)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

40.934kDa

Amino Acid Sequence

MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDHLQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP

Validation Images & Assay Conditions

Gene/Protein Information For ABO (Source: Uniprot.org, NCBI)

Gene Name

ABO

Full Name

Histo-blood group ABO system transferase

Weight

40.934kDa

Superfamily

glycosyltransferase 6 family

Alternative Names

A transferase; A3GALNT; A3GALT1; ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase;transferase B, alpha 1-3-galactosyltransferase); ABO glycosyltransferase; B transferase; B(A) alpha-1,3-galactosyltransferase; EC 2.4.1.37; EC 2.4.1.40; Fucosylglycoprotein 3-alpha-galactosyltransferase; Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase; Glycoprotein-fucosylgalactoside alpha-galactosyltransferase; Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase; GTB; Histo-blood group A transferase; histo-blood group A2 transferase; histo-blood group AB ABO A3GALNT, A3GALT1, GTB, NAGAT ABO, alpha 1-3-N-acetylgalactosaminyltransferase and alpha 1-3-galactosyltransferase histo-blood group ABO system transferase|ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase)|B(A) alpha-1,3-galactosyltransferase|histo-blood group A2 transferase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ABO, check out the ABO Infographic

ABO infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ABO: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP16442

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ABO (NM_020469) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ABO (NM_020469) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ABO (NM_020469) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP16442
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.