Acyl CoA Thioesterase 9 (ACOT9) (NM_001037171) Human Recombinant Protein

CGI-16 protein,

Recombinant protein of human acyl-CoA thioesterase 9 (ACOT9), transcript variant 1

Product Info Summary

SKU: PROTQ9Y305
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Acyl CoA Thioesterase 9 (ACOT9) (NM_001037171) Human Recombinant Protein

View all CGI-16 recombinant proteins

SKU/Catalog Number

PROTQ9Y305

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human acyl-CoA thioesterase 9 (ACOT9), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

Acyl CoA Thioesterase 9 (ACOT9) (NM_001037171) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y305)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

49.902kDa

Amino Acid Sequence

MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEACSSIHVNHVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDPKTISFRSRVLPSNAVWMENSKLKSLEICHPQERNIFNRIFGGFLMRKAYELAWATACSFGGSRPFVVAVDDIMFQKPVEVGSLLFLSSQVCFTQNNYIQVRVHSEVASLQEKQHTTTNVFHFTFMSEKEVPLVFPKTYGESMLYLDGQRHFNSMSGPATLRKDYLVEP

Validation Images & Assay Conditions

Gene/Protein Information For ACOT9 (Source: Uniprot.org, NCBI)

Gene Name

ACOT9

Full Name

Acyl-coenzyme A thioesterase 9, mitochondrial

Weight

49.902kDa

Superfamily

acyl coenzyme A hydrolase family

Alternative Names

ACATE2; Acyl-CoA thioester hydrolase 9; acyl-CoA thioesterase 9acyl-Coenzyme A thioesterase 2, mitochondrial; acyl-coenzyme A thioesterase 9, mitochondrial; CGI-16; EC 3.1.2; EC 3.1.2.-; EC 3.1.2.15; mitochondrial Acyl-CoA Thioesterase; MT-ACT48 ACOT9 ACATE2, CGI-16, MT-ACT48, MTACT48 acyl-CoA thioesterase 9 acyl-coenzyme A thioesterase 9, mitochondrial|acyl-CoA thioester hydrolase 9|acyl-Coenzyme A thioesterase 2, mitochondrial|mitochondrial Acyl-CoA Thioesterase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ACOT9, check out the ACOT9 Infographic

ACOT9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ACOT9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y305

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Acyl CoA Thioesterase 9 (ACOT9) (NM_001037171) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Acyl CoA Thioesterase 9 (ACOT9) (NM_001037171) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Acyl CoA Thioesterase 9 (ACOT9) (NM_001037171) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y305
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.