AK6 (NM_016283) Human Recombinant Protein

Adenylate Kinase 6 protein,

Product Info Summary

SKU: PROTQ9Y3D8
Size: 20 µg
Source: HEK293T

Product Name

AK6 (NM_016283) Human Recombinant Protein

View all Adenylate Kinase 6 recombinant proteins

SKU/Catalog Number

PROTQ9Y3D8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

AK6 (NM_016283) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y3D8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.061kDa

Amino Acid Sequence

MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS

Validation Images & Assay Conditions

Gene/Protein Information For AK6 (Source: Uniprot.org, NCBI)

Gene Name

AK6

Full Name

Adenylate kinase isoenzyme 6

Weight

20.061kDa

Superfamily

adenylate kinase family

Alternative Names

Nothing Found AK6 AD-004, CGI-137, CINAP, CIP, hCINAP adenylate kinase 6 adenylate kinase isoenzyme 6|ATP-AMP transphosphorylase 6|adrenal gland protein AD-004|coilin interacting nuclear ATPase protein|coilin interacting protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on AK6, check out the AK6 Infographic

AK6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for AK6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y3D8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used AK6 (NM_016283) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For AK6 (NM_016283) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for AK6 (NM_016283) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y3D8
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.