AP2S1 (NM_004069) Human Recombinant Protein

AP2S1 protein,

Recombinant protein of human adaptor-related protein complex 2, sigma 1 subunit (AP2S1), transcript variant AP17

Product Info Summary

SKU: PROTP53680
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

AP2S1 (NM_004069) Human Recombinant Protein

View all AP2S1 recombinant proteins

SKU/Catalog Number

PROTP53680

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human adaptor-related protein complex 2, sigma 1 subunit (AP2S1), transcript variant AP17

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

AP2S1 (NM_004069) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP53680)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.018kDa

Amino Acid Sequence

MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE

Validation Images & Assay Conditions

Gene/Protein Information For AP2S1 (Source: Uniprot.org, NCBI)

Gene Name

AP2S1

Full Name

AP-2 complex subunit sigma

Weight

17.018kDa

Superfamily

adaptor complexes small subunit family

Alternative Names

Adapter-related protein complex 2 sigma subunit; Adaptor protein complex AP-2 subunit sigma; adaptor-related protein complex 2, sigma 1 subunit; AP17HA2 17 kDa subunit; AP-2 complex subunit sigma; CLAPS2AP17-DELTA; Clathrin assembly protein 2 small chain; Clathrin coat assembly protein AP17; Clathrin coat-associated protein AP17; clathrin-associated/assembly/adaptor protein, small 2 (17kD); Plasma membrane adaptor AP-2 17 kDa protein; sigma2-adaptin AP2S1 AP17, CLAPS2, FBH3, FBHOk, HHC3 adaptor related protein complex 2 subunit sigma 1 AP-2 complex subunit sigma|HA2 17 kDa subunit|adaptor protein complex AP-2 subunit sigma|adaptor related protein complex 2 sigma 1 subunit|clathrin assembly protein 2 sigma small chain|clathrin coat assembly protein AP17|clathrin coat-associated protein AP17|clathrin-associated/assembly/adaptor protein, small 2 (17kD)|plasma membrane adaptor AP-2 17 kDa protein|sigma-2|sigma2-adaptin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on AP2S1, check out the AP2S1 Infographic

AP2S1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for AP2S1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP53680

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used AP2S1 (NM_004069) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For AP2S1 (NM_004069) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for AP2S1 (NM_004069) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP53680
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.