ASPDH (NM_001114598) Human Recombinant Protein

Aspdh protein,

Recombinant protein of human aspartate dehydrogenase domain containing (ASPDH), transcript variant 1

Product Info Summary

SKU: PROTA6ND91
Size: 20 µg
Source: HEK293T

Product Name

ASPDH (NM_001114598) Human Recombinant Protein

View all Aspdh recombinant proteins

SKU/Catalog Number

PROTA6ND91

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human aspartate dehydrogenase domain containing (ASPDH), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

ASPDH (NM_001114598) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA6ND91)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.27kDa

Amino Acid Sequence

MADRGPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNLAALGERRPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHAVFVARGALWGAEDIRRLDAAGGLRSLRVTMATHPDGFRLEGPLAAAHSPGPCTVLYEGPVRGLCPFAPRNSNTMAAAALAAPSLGFDGVIGVLVADTSLTDMHVVDVELSGPRGPTGRSFAVHTRRENPAEPGAVTGSATVTAFWQSLLACCQLPSRPGIHLC

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For Aspdh (Source: Uniprot.org, NCBI)

Gene Name

Aspdh

Full Name

Putative L-aspartate dehydrogenase

Weight

30.27kDa

Superfamily

L-aspartate dehydrogenase family

Alternative Names

aspartate dehydrogenase domain containing; Aspartate dehydrogenase domain-containing protein; EC 1.4.1.21; putative L-aspartate dehydrogenase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Aspdh, check out the Aspdh Infographic

Aspdh infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Aspdh: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTA6ND91

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ASPDH (NM_001114598) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review ASPDH (NM_001114598) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ASPDH (NM_001114598) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTA6ND91
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.