C10orf81 (PLEKHS1) (NM_001193434) Human Recombinant Protein

PLEKHS1 protein,

Purified recombinant protein of Homo sapiens chromosome 10 open reading frame 81 (C10orf81), transcript variant 2.

Product Info Summary

SKU: PROTQ5SXH7
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C10orf81 (PLEKHS1) (NM_001193434) Human Recombinant Protein

View all PLEKHS1 recombinant proteins

SKU/Catalog Number

PROTQ5SXH7

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens chromosome 10 open reading frame 81 (C10orf81), transcript variant 2.

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

C10orf81 (PLEKHS1) (NM_001193434) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ5SXH7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

51.763kDa

Amino Acid Sequence

MQSVQKMFKCHPDEVMSIRTTNREYFLIGHDREKIKDWVSFMSSFRQDIKATQQNTEEELSLGNKRTLFYSSPLLGPSSTSEAVGSSSPRNGLQDKHLMEQSSPGFRQTHLQDLSEATQDVKEENHYLTPRSVLLELDNIIASSDSGESIETDGPDQVSGRIECHYEPMESYFFKETSHESVDSSKEEPQTLPETQDGDLHLQEQGSGIDWCLSPADVEAQTTNDQKGNIPDESQVEKLNVFLSPPDVINYLALTEATGRICVSQWEGPPRLGCIFCHGDHLLAVNDLKPQSLEEVSLFLTRSIQKEKLKLTIGRIPNSETFHAASCMCPSKCQSAAPSQLDKPRLNRAPKRSPAIKKSQQKGARE

Validation Images & Assay Conditions

Gene/Protein Information For PLEKHS1 (Source: Uniprot.org, NCBI)

Gene Name

PLEKHS1

Full Name

Pleckstrin homology domain-containing family S member 1

Weight

51.763kDa

Alternative Names

C10orf81; bA211N11.2; chromosome 10 open reading frame 81; Epididymis luminal protein 185; FLJ23537; HEL185; PH domain-containing protein C10orf81; pleckstrin homology domain containing, family S member 1; RP11-211N11.2 PLEKHS1 C10orf81, HEL185 pleckstrin homology domain containing S1 pleckstrin homology domain-containing family S member 1|PH domain-containing family S member 1|PH domain-containing protein C10orf81|epididymis luminal protein 185|epididymis secretory sperm binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PLEKHS1, check out the PLEKHS1 Infographic

PLEKHS1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PLEKHS1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ5SXH7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C10orf81 (PLEKHS1) (NM_001193434) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C10orf81 (PLEKHS1) (NM_001193434) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C10orf81 (PLEKHS1) (NM_001193434) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ5SXH7
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.