C15orf24 (EMC7) (NM_020154) Human Recombinant Protein

EMC7 protein,

Recombinant protein of human chromosome 15 open reading frame 24 (C15orf24)

Product Info Summary

SKU: PROTQ9NPA0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C15orf24 (EMC7) (NM_020154) Human Recombinant Protein

View all EMC7 recombinant proteins

SKU/Catalog Number

PROTQ9NPA0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 15 open reading frame 24 (C15orf24)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

C15orf24 (EMC7) (NM_020154) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NPA0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

26.471kDa

Amino Acid Sequence

MAAALWGFFPVLLLLLLSGDVQSSEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTDFLMNPMVMMMVLPLLIFVLLPKVVNTSDPDMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSSGKSSSGSSKTGKSGAGKRR

Validation Images & Assay Conditions

Gene/Protein Information For EMC7 (Source: Uniprot.org, NCBI)

Gene Name

EMC7

Full Name

ER membrane protein complex subunit 7

Weight

26.471kDa

Superfamily

EMC7 family

Alternative Names

C11orf3; C15orf24; chromosome 15 hypothetical ATG/GTP binding protein; chromosome 15 open reading frame 24; ER membrane protein complex subunit 7; HT022; ORF1-FL1 EMC7 C11orf3, C15orf24, HT022, ORF1-FL1 ER membrane protein complex subunit 7 ER membrane protein complex subunit 7|UPF0480 protein C15orf24|chromosome 15 hypothetical ATG/GTP binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EMC7, check out the EMC7 Infographic

EMC7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EMC7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NPA0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C15orf24 (EMC7) (NM_020154) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C15orf24 (EMC7) (NM_020154) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C15orf24 (EMC7) (NM_020154) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NPA0
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.