C2orf76 (NM_001017927) Human Recombinant Protein

C2orf76 protein,

Recombinant protein of human chromosome 2 open reading frame 76 (C2orf76)

Product Info Summary

SKU: PROTQ3KRA6
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C2orf76 (NM_001017927) Human Recombinant Protein

View all C2orf76 recombinant proteins

SKU/Catalog Number

PROTQ3KRA6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 2 open reading frame 76 (C2orf76)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C2orf76 (NM_001017927) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ3KRA6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.4 kDa

Amino Acid Sequence

MAPGEVTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVFLKQDVPLRTNLPPPFRNYKYDALKIIHQAHKSKTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDYRNYKANPISSW

Validation Images & Assay Conditions

Gene/Protein Information For C2orf76 (Source: Uniprot.org, NCBI)

Gene Name

C2orf76

Full Name

UPF0538 protein C2orf76

Weight

14.4 kDa

Superfamily

UPF0538 family

Alternative Names

AIM29; chromosome 2 open reading frame 76; hypothetical protein LOC130355; LOC130355; MGC104437 C2orf76 AIM29 chromosome 2 open reading frame 76 UPF0538 protein C2orf76

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on C2orf76, check out the C2orf76 Infographic

C2orf76 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for C2orf76: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ3KRA6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C2orf76 (NM_001017927) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C2orf76 (NM_001017927) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C2orf76 (NM_001017927) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ3KRA6
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.