CBX1 (NM_006807) Human Recombinant Protein

CBX1 protein,

Product Info Summary

SKU: PROTP83916
Size: 20 µg
Source: HEK293T

Product Name

CBX1 (NM_006807) Human Recombinant Protein

View all CBX1 recombinant proteins

SKU/Catalog Number

PROTP83916

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromobox homolog 1 (HP1 beta homolog Drosophila ) (CBX1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CBX1 (NM_006807) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP83916)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.2 kDa

Amino Acid Sequence

MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN

Validation Images & Assay Conditions

Gene/Protein Information For CBX1 (Source: Uniprot.org, NCBI)

Gene Name

CBX1

Full Name

Chromobox protein homolog 1

Weight

21.2 kDa

Alternative Names

CBXM31HP1-BETA; chromobox homolog 1 (Drosophila HP1 beta); chromobox homolog 1 (HP1 beta homolog Drosophila ); chromobox homolog 1; chromobox protein homolog 1; Heterochromatin protein 1 homolog beta; heterochromatin protein 1-beta; heterochromatin protein p25 beta; Heterochromatin protein p25; HP1 beta homolog; HP1 beta; HP1Hsbeta; HP1Hs-beta; MOD1; Modifier 1 protein; p25beta CBX1 CBX, HP1-BETA, HP1Hs-beta, HP1Hsbeta, M31, MOD1, p25beta chromobox 1 chromobox protein homolog 1|HP1 beta homolog|chromobox homolog 1 (HP1 beta homolog Drosophila )|heterochromatin protein 1 homolog beta|heterochromatin protein 1-beta|heterochromatin protein p25 beta|modifier 1 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CBX1, check out the CBX1 Infographic

CBX1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CBX1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP83916

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CBX1 (NM_006807) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CBX1 (NM_006807) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CBX1 (NM_006807) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP83916
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.