HDHD1A (PUDP) (NM_012080) Human Recombinant Protein

HDHD1A protein,

Product Info Summary

SKU: PROTQ08623
Size: 20 µg
Source: HEK293T

Product Name

HDHD1A (PUDP) (NM_012080) Human Recombinant Protein

View all HDHD1A recombinant proteins

SKU/Catalog Number

PROTQ08623

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human haloacid dehalogenase-like hydrolase domain containing 1A (HDHD1A), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

HDHD1A (PUDP) (NM_012080) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ08623)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.249kDa

Amino Acid Sequence

MDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYE

Validation Images & Assay Conditions

Gene/Protein Information For PUDP (Source: Uniprot.org, NCBI)

Gene Name

PUDP

Full Name

Pseudouridine-5'-phosphatase

Weight

25.249kDa

Superfamily

HAD-like hydrolase superfamily

Alternative Names

DXF68S1E5'-PsiMPase; EC 3.1.3.n6; family with sequence similarity 16, member A, X-linked; GS1FAM16AX; haloacid dehalogenase-like hydrolase domain containing 1; haloacid dehalogenase-like hydrolase domain containing 1A; Haloacid dehalogenase-like hydrolase domain-containing protein 1; Haloacid dehalogenase-like hydrolase domain-containing protein 1A; HDHD1Apseudouridine-5'-monophosphatase; Protein GS1 PUDP DXF68S1E, FAM16AX, GS1, HDHD1, HDHD1A pseudouridine 5-phosphatase pseudouridine-5-phosphatase|5-PsiMPase|family with sequence similarity 16, member A, X-linked|haloacid dehalogenase-like hydrolase domain containing 1|haloacid dehalogenase-like hydrolase domain containing 1A|haloacid dehalogenase-like hydrolase domain-containing protein 1|haloacid dehalogenase-like hydrolase domain-containing protein 1A|pseudouridine-5-monophosphatase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PUDP, check out the PUDP Infographic

PUDP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PUDP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ08623

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HDHD1A (PUDP) (NM_012080) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HDHD1A (PUDP) (NM_012080) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HDHD1A (PUDP) (NM_012080) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ08623
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.