HLA DOB (HLA-DOB) (NM_002120) Human Recombinant Protein

HLA DOB protein,

Product Info Summary

SKU: PROTP13765
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HLA DOB (HLA-DOB) (NM_002120) Human Recombinant Protein

View all HLA DOB recombinant proteins

SKU/Catalog Number

PROTP13765

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human major histocompatibility complex, class II, DO beta (HLA-DOB)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HLA DOB (HLA-DOB) (NM_002120) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP13765)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.6 kDa

Amino Acid Sequence

MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWTFQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLLVGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC

Validation Images & Assay Conditions

Gene/Protein Information For HLA-DOB (Source: Uniprot.org, NCBI)

Gene Name

HLA-DOB

Full Name

HLA class II histocompatibility antigen, DO beta chain

Weight

30.6 kDa

Superfamily

MHC class II family

Alternative Names

DOB; FLJ57033; HLA class II histocompatibility antigen, DO beta chain; major histocompatibility complex, class II, DO beta; MHC class II antigen DOB HLA-DOB DOB, HLA_DOB major histocompatibility complex, class II, DO beta HLA class II histocompatibility antigen, DO beta chain|MHC class II antigen DOB

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HLA-DOB, check out the HLA-DOB Infographic

HLA-DOB infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HLA-DOB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP13765

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HLA DOB (HLA-DOB) (NM_002120) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HLA DOB (HLA-DOB) (NM_002120) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HLA DOB (HLA-DOB) (NM_002120) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP13765
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.