Human/Mouse/Rat recombinant BDNF (Brain-derived neurotrophic factor) protein, AF

BDNF protein, Human, Mouse, Rat

Brain-derived neurotrophic factor (BDNF) is a member of neurotrophin family that not only primarily expressed in hippocampus, amygdala, cerebral cortex, hypothalamus and cerebellum but also has been detected in blood platelets and in circulating plasma. BDNF is a 27.8 kDa protein containing 247 residues, which plays a critical role in regulating synaptic transmission and plasticity in various region of the CNS. Additionally, BNDF can acts as a modulator in the long-term potentiation of memory-related modifications in hippocampal synaptic transmission.

Product Info Summary

SKU: PROTP23560-5
Size: 5ug,20ug,100ug
Origin Species: Human, Mouse, Rat
Source: Escherichia coli
Application: Cell Culture

Product Name

Human/Mouse/Rat recombinant BDNF (Brain-derived neurotrophic factor) protein, AF

View all BDNF recombinant proteins

SKU/Catalog Number

PROTP23560-5

Size

5ug,20ug,100ug

Tag

His Tag (C-term)

Description

Brain-derived neurotrophic factor (BDNF) is a member of neurotrophin family that not only primarily expressed in hippocampus, amygdala, cerebral cortex, hypothalamus and cerebellum but also has been detected in blood platelets and in circulating plasma. BDNF is a 27.8 kDa protein containing 247 residues, which plays a critical role in regulating synaptic transmission and plasticity in various region of the CNS. Additionally, BNDF can acts as a modulator in the long-term potentiation of memory-related modifications in hippocampal synaptic transmission.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Human/Mouse/Rat recombinant BDNF (Brain-derived neurotrophic factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP23560-5)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Molecular weight

The protein has a calculated MW of 14.45 kDa. The protein migrates as 14 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce proliferation in BaF3 cells transfected with TrkB. The ED₅₀ for this effect is <2 ng/mL.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Human/Mouse/Rat recombinant BDNF (Brain-derived neurotrophic factor) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Human/Mouse/Rat recombinant BDNF (Brain-derived neurotrophic factor) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Human/Mouse/Rat recombinant BDNF (Brain-derived neurotrophic factor) protein, AF

Size

Total: $77.00

SKU:PROTP23560-5

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP23560-5
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: May 19, 2026