Click image to see more details
Product Info Summary
| SKU: | PROTP01584-6 |
|---|---|
| Size: | 100ug,1mg |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture, ELISA |
Product info
Product Name
Human recombinant IL-1 beta protein, GMP
View all IL1B recombinant proteins
SKU/Catalog Number
PROTP01584-6
Size
100ug,1mg
Tag
His Tag (C-term)
Description
Interleukin-1 beta (IL-1β) is a major cytokine expressed in macrophage, NK cells, monocytes, and neutrophils. It also plays fundamental role in inflammatory response, including monocyte activation, which is essential for the host defense and pathogen and pathogen resistance. Pro-IL-1β is cleaved by cytosolic caspase 1 to form mature IL-1β.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant IL-1 beta protein, GMP (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01584-6)
Form
Lyophilized
Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.
Purity
>98% as determined by SDS-PAGE analysis.
Predicted MW
30.7 kDa
Molecular weight
The protein has a calculated MW of 18.5 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce IL-8 secretion in HT29 cells. The ED₅₀ for this effect is <2.0 ng/mL. The specific activity of recombinant human IL-1 beta is approximately >3 x 10⁷ IU/mg, which is calibrated against the human IL-1 beta WHO International Standard (NIBSC code: 86/680).
Endotoxin
<0.05 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MASAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of GMP human IL-1 beta
Specific Publications For Human recombinant IL-1 beta protein, GMP (PROTP01584-6)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant IL-1 beta protein, GMP?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant IL-1 beta protein, GMP
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
