Human recombinant Noggin protein, AF

NOG protein, Human

Noggin is a 46.2 kDa bioactive protein, which exists as a disulfide-linked homodimer (each chain 23.1 kDa). Noggin binds members of the transforming Growth Factors-beta (TGF beta) superfamily signaling proteins, such as bone morphogenetic protein-4 (BMP-4), which inactivates their activities. As a extracellular antagonist of BMP proteins, Noggin involves in the development of many body tissues, including nerve tissue, muscles, and bones. In addition, Noggin is able to inhibit chondrocyte differentiation through its interaction with GDF5.

Product Info Summary

SKU: PROTQ13253-6
Size: 5ug,20ug,100ug
Origin Species: Human
Source: HEK293 cell
Application: Cell Culture

Product Name

Human recombinant Noggin protein, AF

View all NOG recombinant proteins

SKU/Catalog Number

PROTQ13253-6

Size

5ug,20ug,100ug

Tag

Fc Tag (C-term)

Description

Noggin is a 46.2 kDa bioactive protein, which exists as a disulfide-linked homodimer (each chain 23.1 kDa). Noggin binds members of the transforming Growth Factors-beta (TGF beta) superfamily signaling proteins, such as bone morphogenetic protein-4 (BMP-4), which inactivates their activities. As a extracellular antagonist of BMP proteins, Noggin involves in the development of many body tissues, including nerve tissue, muscles, and bones. In addition, Noggin is able to inhibit chondrocyte differentiation through its interaction with GDF5.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Human recombinant Noggin protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13253-6)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

25.8 kDa

Molecular weight

The protein has a calculated MW of 49.11 kDa. The protein migrates as 58 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <0.05 μg/mL in the presence of 50 ng/mL of recombinant human BMP-4.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC with Fc tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Human recombinant Noggin protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Human recombinant Noggin protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Human recombinant Noggin protein, AF

Size

Total: $77.00

SKU:PROTQ13253-6

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTQ13253-6
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Jun 1, 2026