Click image to see more details
Product Info Summary
| SKU: | PROTP21246-3 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Product info
Product Name
Human recombinant Pleiotrophin protein, AF
View all PTN recombinant proteins
SKU/Catalog Number
PROTP21246-3
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Pleiotrophin (PTN) also known as HB-GAM, which is a Growth Factors involves in widely range of biological events such as bone development, neural regeneration, inflammatory response, tissue repair. PTN is 18.9 kDa protein containing 168 residues that expressed in Osteoblast and brain. Besides, PTN has been revealed to suppress the long-term potentiation (LTP) in hippocampus and plays a critical role in modulating learning-related behavior. On the other hand, PTN also acts as an angiogenic factor that promotes tumor progression by PTN/Anaplastic Lymphoma Kinase (ALK) axis.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant Pleiotrophin protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP21246-3)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
18.9 kDa
Molecular weight
The protein has a calculated MW of 19.89 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Activity
Testing in process
Endotoxin
<0.01 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human Pleiotrophin
Specific Publications For Human recombinant Pleiotrophin protein, AF (PROTP21246-3)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant Pleiotrophin protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant Pleiotrophin protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
